RL22 - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

RL22 - 50S ribosomal protein L22

UniProt:	P42060	Sequences: MQAKAVARTVRIAPRKARLVMDLIRGKQVGEAVSILNLTPRAASPIIEKVLKSAIANAEHNYEMDANNLVISQAFVDEGPTLKRFRPRAMGRASQINKRTSHITIVVSEKKEG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	113 (107)
Sequences:	2245 (1066)
Seq/√Len:	103.0

ECOLI - RL22
BACSU - RL22

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
7_A	50_V	2.670	1.00
48_E	52_K	2.437	1.00
9_T	80_P	2.424	1.00
7_A	10_V	2.419	1.00
21_M	76_V	2.373	1.00
21_M	74_A	2.238	1.00
72_S	108_S	2.206	1.00
29_V	55_I	2.161	1.00
85_F	93_A	2.105	1.00
27_K	35_I	2.084	1.00
27_K	31_E	2.031	1.00
37_N	48_E	2.022	1.00
22_D	25_R	1.976	1.00
88_R	94_S	1.916	1.00
78_E	81_T	1.840	1.00
24_I	51_L	1.739	1.00
42_A	46_I	1.702	1.00
81_T	97_N	1.689	1.00
33_V	48_E	1.660	1.00
21_M	47_I	1.641	1.00
51_L	55_I	1.624	1.00
51_L	105_I	1.611	1.00
68_N	109_E	1.551	1.00
81_T	99_R	1.543	1.00
18_R	77_D	1.537	1.00
78_E	99_R	1.529	1.00
85_F	94_S	1.518	1.00
59_E	66_A	1.511	1.00
85_F	95_Q	1.469	1.00
10_V	46_I	1.465	1.00
73_Q	106_V	1.461	1.00
12_I	17_A	1.436	1.00
19_L	41_R	1.431	1.00
86_R	94_S	1.419	1.00
12_I	43_A	1.419	1.00
17_A	103_I	1.393	1.00
28_Q	31_E	1.382	1.00
75_F	104_T	1.379	1.00
72_S	106_V	1.337	0.99
74_A	105_I	1.308	0.99
33_V	55_I	1.296	0.99
77_D	104_T	1.271	0.99
51_L	71_I	1.267	0.99
3_A	107_V	1.223	0.99
58_A	69_L	1.203	0.99
50_V	103_I	1.185	0.99
18_R	78_E	1.185	0.99
61_N	64_M	1.167	0.98
87_P	94_S	1.112	0.98
33_V	51_L	1.088	0.97
3_A	62_Y	1.077	0.97
33_V	52_K	1.044	0.97
64_M	109_E	1.036	0.97
79_G	100_T	1.034	0.97
14_P	18_R	0.983	0.95
79_G	102_H	0.980	0.95
87_P	93_A	0.979	0.95
6_V	77_D	0.977	0.95
17_A	47_I	0.970	0.95
23_L	39_T	0.968	0.95
24_I	74_A	0.963	0.95
23_L	27_K	0.960	0.95
5_A	53_S	0.949	0.94
18_R	22_D	0.947	0.94
65_D	68_N	0.942	0.94
47_I	74_A	0.935	0.94
25_R	73_Q	0.931	0.94
14_P	78_E	0.924	0.94
89_A	94_S	0.920	0.93
43_A	46_I	0.920	0.93
90_M	94_S	0.909	0.93
50_V	107_V	0.908	0.93
23_L	35_I	0.878	0.92
12_I	46_I	0.877	0.92
15_R	19_L	0.876	0.92
80_P	100_T	0.872	0.92
30_G	66_A	0.850	0.90
86_R	96_I	0.850	0.90
12_I	99_R	0.843	0.90
3_A	64_M	0.835	0.90
34_S	38_L	0.827	0.89
5_A	50_V	0.820	0.89
6_V	104_T	0.813	0.88
88_R	96_I	0.805	0.88
31_E	34_S	0.792	0.87
90_M	93_A	0.773	0.86
50_V	105_I	0.772	0.86
15_R	97_N	0.771	0.86
70_V	108_S	0.767	0.85
14_P	101_S	0.762	0.85
13_A	42_A	0.761	0.85
69_L	107_V	0.754	0.84
25_R	72_S	0.744	0.84
59_E	64_M	0.727	0.82
71_I	74_A	0.725	0.82
31_E	35_I	0.713	0.81
8_R	102_H	0.712	0.81
35_I	39_T	0.708	0.80
53_S	57_N	0.705	0.80
25_R	75_F	0.687	0.78
9_T	102_H	0.678	0.77
77_D	102_H	0.676	0.77
33_V	37_N	0.669	0.77
52_K	56_A	0.663	0.76
65_D	92_R	0.661	0.76
42_A	45_P	0.656	0.75
76_V	101_S	0.652	0.75
87_P	91_G	0.639	0.73
24_I	42_A	0.627	0.72
30_G	34_S	0.622	0.71
80_P	102_H	0.620	0.71
60_H	90_M	0.619	0.71
17_A	46_I	0.616	0.70
10_V	103_I	0.613	0.70
72_S	107_V	0.611	0.70
4_K	106_V	0.609	0.70
14_P	81_T	0.597	0.68
27_K	70_V	0.586	0.67
62_Y	68_N	0.586	0.67
93_A	96_I	0.583	0.66
17_A	43_A	0.582	0.66
47_I	76_V	0.580	0.66
86_R	93_A	0.579	0.66
45_P	48_E	0.576	0.65
44_S	48_E	0.575	0.65
40_P	46_I	0.570	0.65
60_H	64_M	0.568	0.64
64_M	68_N	0.567	0.64
70_V	109_E	0.563	0.64
12_I	101_S	0.562	0.63
88_R	95_Q	0.560	0.63
11_R	80_P	0.559	0.63
26_G	29_V	0.559	0.63
32_A	93_A	0.559	0.63
53_S	56_A	0.557	0.63
76_V	103_I	0.551	0.62
11_R	101_S	0.550	0.62
17_A	101_S	0.543	0.61
89_A	100_T	0.536	0.60
11_R	84_R	0.535	0.60
30_G	33_V	0.532	0.59
38_L	45_P	0.529	0.59
24_I	71_I	0.525	0.58
32_A	84_R	0.524	0.58
3_A	56_A	0.521	0.58
30_G	38_L	0.520	0.58
39_T	43_A	0.519	0.57
17_A	100_T	0.518	0.57
47_I	103_I	0.515	0.57
18_R	107_V	0.512	0.56
84_R	93_A	0.509	0.56
29_V	33_V	0.507	0.56
4_K	73_Q	0.506	0.56
4_K	8_R	0.506	0.56
11_R	76_V	0.505	0.55
82_L	98_K	0.504	0.55
55_I	66_A	0.502	0.55
81_T	100_T	0.501	0.55
55_I	69_L	0.501	0.55
56_A	60_H	0.500	0.55

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3j3wS	1	0.9912	100	0.128	Contact Map
4tp9S	1	0.9735	100	0.133	Contact Map
3bboU	1	1	100	0.147	Contact Map
2zjrP	1	1	100	0.172	Contact Map
4ce4W	1	0.9646	100	0.172	Contact Map
3j7yT	1	1	100	0.174	Contact Map
1i4jA	2	0.9646	100	0.175	Contact Map
1vw4O	1	0.9912	100	0.192	Contact Map
4a17Q	1	0.9912	100	0.223	Contact Map
3j3bP	1	0.9646	100	0.225	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0058 seconds.