SP5AC - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

SP5AC - Stage V sporulation protein AC

UniProt:	P40868	Sequences: MTNIKENYKSKVKTYQPKPPYVWNCVKAFLVGGLICAIGQGLQNFYIHFFDFNEKTAGNPTAATLILISALLTGFGIYDRIGQFAGAGSAVPVTGFANSMASAALEYKSEGLVLGVATNMFKLAGNVIVFGVVAAYIVGMIRFAFEKLMS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	150 (141)
Sequences:	669 (458)
Seq/√Len:	38.6

BACSU - SP5AC

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
46_Y	64_T	7.805	1.00
82_G	89_S	4.320	1.00
67_L	71_L	3.577	1.00
119_N	122_K	3.222	1.00
70_A	101_A	2.977	1.00
53_N	56_T	2.906	1.00
40_Q	44_N	2.728	1.00
123_L	126_N	2.706	1.00
11_K	15_Y	2.630	1.00
27_K	30_L	2.479	1.00
72_L	81_I	2.366	1.00
27_K	84_F	2.286	1.00
120_M	129_V	2.249	0.99
23_W	27_K	2.247	0.99
128_I	132_V	2.239	0.99
52_F	60_P	2.220	0.99
68_I	72_L	2.058	0.99
34_L	38_I	2.033	0.99
112_L	116_V	1.966	0.99
41_G	45_F	1.946	0.98
42_L	46_Y	1.942	0.98
62_A	93_V	1.874	0.98
71_L	74_G	1.801	0.97
101_A	105_L	1.800	0.97
72_L	77_I	1.759	0.97
34_L	37_A	1.662	0.96
138_V	141_I	1.644	0.96
42_L	65_L	1.557	0.94
45_F	50_F	1.555	0.94
31_V	85_A	1.426	0.91
37_A	41_G	1.416	0.91
38_I	68_I	1.396	0.90
117_A	129_V	1.375	0.89
43_Q	57_A	1.364	0.89
85_A	89_S	1.343	0.88
20_P	23_W	1.330	0.88
63_A	93_V	1.272	0.85
97_A	101_A	1.266	0.85
21_Y	25_C	1.262	0.85
58_G	61_T	1.262	0.85
69_S	78_Y	1.239	0.84
6_E	9_K	1.210	0.82
16_Q	19_P	1.196	0.81
139_G	142_R	1.175	0.80
100_M	133_V	1.157	0.79
19_P	24_N	1.152	0.79
43_Q	61_T	1.132	0.78
65_L	78_Y	1.127	0.77
86_G	98_N	1.119	0.77
70_A	97_A	1.118	0.77
22_V	26_V	1.096	0.75
37_A	69_S	1.080	0.74
103_A	107_Y	1.077	0.74
31_V	84_F	1.070	0.73
65_L	94_T	1.054	0.72
105_L	108_K	1.040	0.71
30_L	37_A	1.028	0.70
66_I	112_L	1.019	0.70
133_V	137_I	1.018	0.70
46_Y	60_P	0.991	0.68
65_L	69_S	0.978	0.66
8_Y	12_V	0.967	0.66
42_L	64_T	0.967	0.66
68_I	71_L	0.967	0.66
100_M	128_I	0.953	0.64
100_M	112_L	0.945	0.64
52_F	59_N	0.944	0.64
100_M	129_V	0.940	0.63
117_A	120_M	0.917	0.61
82_G	87_A	0.916	0.61
59_N	62_A	0.912	0.61
128_I	133_V	0.910	0.61
101_A	126_N	0.893	0.59
14_T	18_K	0.879	0.58
78_Y	89_S	0.877	0.58
65_L	91_V	0.873	0.58
119_N	126_N	0.863	0.57
42_L	45_F	0.850	0.56
114_L	135_A	0.844	0.55
50_F	63_A	0.842	0.55
67_L	75_F	0.836	0.54
133_V	136_Y	0.831	0.54
46_Y	61_T	0.829	0.54
36_C	90_A	0.829	0.54
30_L	34_L	0.818	0.53
99_S	126_N	0.818	0.53
26_V	30_L	0.817	0.53
102_S	134_A	0.817	0.53
41_G	44_N	0.816	0.53
61_T	78_Y	0.815	0.52
108_K	112_L	0.810	0.52
35_I	89_S	0.809	0.52
112_L	117_A	0.797	0.51
11_K	16_Q	0.784	0.50
82_G	91_V	0.781	0.49
21_Y	117_A	0.770	0.48
38_I	65_L	0.766	0.48
45_F	52_F	0.764	0.48
99_S	124_A	0.760	0.48
50_F	107_Y	0.755	0.47
81_I	114_L	0.750	0.47
34_L	85_A	0.745	0.46
104_A	120_M	0.743	0.46
129_V	133_V	0.733	0.45
59_N	63_A	0.733	0.45
105_L	109_S	0.727	0.45
47_I	54_E	0.726	0.44
12_V	82_G	0.724	0.44
31_V	89_S	0.724	0.44
15_Y	18_K	0.723	0.44
64_T	71_L	0.722	0.44
34_L	48_H	0.720	0.44
12_V	16_Q	0.715	0.43
38_I	41_G	0.714	0.43
16_Q	117_A	0.713	0.43
28_A	86_G	0.711	0.43
58_G	62_A	0.709	0.43
4_I	7_N	0.707	0.43
67_L	78_Y	0.702	0.42
10_S	75_F	0.697	0.42
119_N	134_A	0.695	0.42
34_L	41_G	0.691	0.41
67_L	109_S	0.688	0.41
10_S	14_T	0.684	0.41
67_L	112_L	0.682	0.41
36_C	98_N	0.678	0.40
87_A	98_N	0.673	0.40
117_A	133_V	0.672	0.40
68_I	75_F	0.672	0.40
64_T	68_I	0.671	0.40
52_F	56_T	0.666	0.39
141_I	145_F	0.666	0.39
39_G	78_Y	0.666	0.39
38_I	81_I	0.655	0.38
44_N	48_H	0.655	0.38
82_G	98_N	0.654	0.38
51_D	126_N	0.649	0.38
57_A	105_L	0.634	0.36
71_L	101_A	0.633	0.36
110_E	116_V	0.629	0.36
13_K	58_G	0.626	0.36
12_V	15_Y	0.626	0.36
7_N	117_A	0.624	0.36
76_G	135_A	0.624	0.36
8_Y	65_L	0.614	0.35
9_K	64_T	0.611	0.35
7_N	10_S	0.610	0.35
9_K	145_F	0.610	0.35
103_A	128_I	0.608	0.34
74_G	105_L	0.607	0.34
83_Q	109_S	0.604	0.34
19_P	76_G	0.603	0.34
113_V	127_V	0.600	0.34
30_L	41_G	0.599	0.34
19_P	116_V	0.599	0.34
57_A	61_T	0.597	0.33
87_A	127_V	0.596	0.33
107_Y	118_T	0.595	0.33
53_N	61_T	0.594	0.33
55_K	58_G	0.594	0.33
7_N	137_I	0.592	0.33
81_I	89_S	0.590	0.33
56_T	105_L	0.586	0.33
52_F	118_T	0.583	0.32
11_K	14_T	0.583	0.32
128_I	137_I	0.581	0.32
101_A	128_I	0.578	0.32
42_L	61_T	0.576	0.32
31_V	34_L	0.575	0.32
28_A	135_A	0.575	0.32
83_Q	119_N	0.574	0.32
74_G	101_A	0.571	0.31
37_A	44_N	0.570	0.31
104_A	118_T	0.568	0.31
10_S	13_K	0.567	0.31
43_Q	58_G	0.566	0.31
57_A	97_A	0.563	0.31
76_G	79_D	0.562	0.31
137_I	141_I	0.562	0.31
13_K	31_V	0.559	0.30
122_K	136_Y	0.555	0.30
79_D	85_A	0.555	0.30
79_D	105_L	0.554	0.30
75_F	85_A	0.549	0.30
65_L	85_A	0.549	0.30
7_N	26_V	0.548	0.30
31_V	38_I	0.547	0.30
116_V	142_R	0.546	0.30
36_C	86_G	0.544	0.29
39_G	65_L	0.543	0.29
82_G	99_S	0.543	0.29
25_C	66_I	0.542	0.29
12_V	136_Y	0.542	0.29
114_L	132_V	0.542	0.29
71_L	75_F	0.541	0.29
60_P	135_A	0.534	0.29
99_S	107_Y	0.527	0.28
5_K	84_F	0.527	0.28
57_A	75_F	0.526	0.28
54_E	144_A	0.525	0.28
85_A	145_F	0.525	0.28
69_S	101_A	0.524	0.28
120_M	128_I	0.522	0.28
36_C	126_N	0.520	0.28
14_T	145_F	0.517	0.27
66_I	75_F	0.517	0.27
94_T	126_N	0.513	0.27
103_A	135_A	0.512	0.27
8_Y	94_T	0.511	0.27
38_I	144_A	0.504	0.26
78_Y	98_N	0.500	0.26
38_I	69_S	0.500	0.26

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2gfpA	2	0.9267	24	0.952	Contact Map
3o7qA	1	0.8733	23	0.952	Contact Map
1pw4A	1	0.8467	18.5	0.954	Contact Map
4lz6A	1	0.96	10.5	0.959	Contact Map
4j05A	3	0.8133	9.8	0.96	Contact Map
4w6vA	1	0.8933	9.2	0.96	Contact Map
3wdoA	1	0.9	9.2	0.96	Contact Map
4xnjA	1	0.9	8.9	0.96	Contact Map
3w4tA	1	0.8267	7	0.962	Contact Map
1byyA	1	0.1067	6.5	0.963	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.006 seconds.