SP5AB - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

SP5AB - Stage V sporulation protein AB

UniProt:	P40867	Sequences: MIVSVLFIIFVGLGGGITVGAGFVAFLTVMGIIPRLMQLTKTMRFVQAYEAAVILGAVCGGWETLHMNHLYLTKWIAVPVGLLAGLFVGMLAAALTEVLNVLPILAKRIGLRSKIIILLMAIVIGKIAGSLFHWLYFIDHS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	141 (134)
Sequences:	287 (244)
Seq/√Len:	21.0

BACSU - SP5AB

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
42_T	49_Y	7.168	1.00
40_T	49_Y	4.042	1.00
33_I	53_V	2.671	0.99
30_M	101_V	2.646	0.98
94_A	98_V	2.331	0.96
17_I	104_I	2.329	0.96
52_A	100_N	2.318	0.96
31_G	60_G	2.136	0.94
79_P	83_L	2.028	0.92
94_A	101_V	1.964	0.91
7_F	110_G	1.933	0.90
26_F	30_M	1.850	0.88
25_A	95_L	1.832	0.88
31_G	64_T	1.816	0.87
14_G	18_T	1.781	0.86
80_V	84_A	1.728	0.85
12_G	81_G	1.714	0.84
27_L	62_W	1.648	0.82
29_V	91_L	1.611	0.80
28_T	133_H	1.588	0.79
53_V	136_Y	1.570	0.78
26_F	31_G	1.555	0.78
72_L	79_P	1.520	0.76
11_V	128_A	1.483	0.74
21_A	57_A	1.459	0.73
39_L	123_V	1.424	0.71
27_L	77_A	1.414	0.70
22_G	103_P	1.383	0.69
42_T	46_V	1.360	0.67
39_L	93_A	1.355	0.67
20_G	93_A	1.352	0.67
63_E	67_M	1.319	0.65
132_F	136_Y	1.308	0.64
60_G	122_I	1.306	0.64
87_F	122_I	1.298	0.64
40_T	46_V	1.287	0.63
40_T	80_V	1.280	0.63
34_P	101_V	1.268	0.62
25_A	100_N	1.253	0.61
29_V	93_A	1.250	0.61
92_A	121_A	1.237	0.60
24_V	57_A	1.224	0.59
52_A	104_I	1.220	0.59
24_V	90_M	1.219	0.59
60_G	64_T	1.215	0.58
15_G	106_A	1.208	0.58
98_V	101_V	1.177	0.56
131_L	135_L	1.165	0.55
6_L	121_A	1.160	0.55
12_G	49_Y	1.160	0.55
115_I	128_A	1.157	0.55
59_C	124_I	1.153	0.54
90_M	134_W	1.151	0.54
9_I	78_V	1.139	0.53
29_V	34_P	1.125	0.53
10_F	110_G	1.108	0.51
48_A	52_A	1.105	0.51
25_A	36_L	1.105	0.51
12_G	20_G	1.098	0.51
28_T	122_I	1.078	0.49
59_C	70_L	1.075	0.49
62_W	80_V	1.071	0.49
20_G	134_W	1.071	0.49
26_F	32_I	1.068	0.49
17_I	21_A	1.061	0.48
36_L	90_M	1.036	0.47
7_F	52_A	1.024	0.46
34_P	130_S	1.024	0.46
22_G	84_A	1.021	0.46
19_V	92_A	1.018	0.45
24_V	39_L	1.012	0.45
40_T	67_M	1.001	0.44
107_K	118_L	0.984	0.43
116_I	120_M	0.982	0.43
86_L	99_L	0.977	0.43
22_G	132_F	0.971	0.42
13_L	135_L	0.967	0.42
91_L	102_L	0.966	0.42
40_T	48_A	0.957	0.41
93_A	96_T	0.953	0.41
23_F	41_K	0.952	0.41
7_F	79_P	0.940	0.40
61_G	64_T	0.931	0.40
37_M	50_E	0.926	0.39
27_L	53_V	0.923	0.39
53_V	58_V	0.919	0.39
62_W	66_H	0.915	0.39
96_T	103_P	0.906	0.38
9_I	44_R	0.901	0.38
15_G	100_N	0.900	0.38
7_F	86_L	0.900	0.38
79_P	128_A	0.893	0.37
45_F	79_P	0.887	0.37
11_V	124_I	0.886	0.37
41_K	105_L	0.885	0.37
39_L	92_A	0.883	0.37
116_I	119_L	0.867	0.36
14_G	128_A	0.866	0.36
53_V	126_K	0.861	0.35
6_L	9_I	0.860	0.35
55_L	104_I	0.858	0.35
3_V	121_A	0.846	0.35
59_C	68_N	0.839	0.34
110_G	127_I	0.839	0.34
19_V	101_V	0.837	0.34
75_W	92_A	0.835	0.34
107_K	134_W	0.832	0.34
63_E	77_A	0.829	0.34
35_R	38_Q	0.827	0.33
30_M	83_L	0.824	0.33
130_S	134_W	0.817	0.33
59_C	63_E	0.817	0.33
83_L	118_L	0.811	0.32
13_L	122_I	0.805	0.32
94_A	102_L	0.783	0.31
32_I	130_S	0.770	0.30
4_S	109_I	0.753	0.29
10_F	14_G	0.742	0.29
4_S	78_V	0.735	0.28
13_L	109_I	0.732	0.28
30_M	91_L	0.723	0.28
38_Q	92_A	0.719	0.27
11_V	82_L	0.717	0.27
76_I	99_L	0.717	0.27
77_A	115_I	0.710	0.27
10_F	98_V	0.709	0.27
72_L	124_I	0.705	0.27
52_A	63_E	0.698	0.26
18_T	21_A	0.688	0.26
57_A	93_A	0.687	0.26
7_F	10_F	0.685	0.26
19_V	29_V	0.683	0.25
70_L	73_T	0.683	0.25
13_L	129_G	0.680	0.25
8_I	11_V	0.676	0.25
7_F	124_I	0.675	0.25
54_I	86_L	0.675	0.25
41_K	116_I	0.674	0.25
44_R	128_A	0.669	0.25
26_F	133_H	0.669	0.25
52_A	79_P	0.661	0.24
45_F	48_A	0.652	0.24
72_L	128_A	0.642	0.23
38_Q	110_G	0.640	0.23
36_L	93_A	0.635	0.23
102_L	127_I	0.631	0.23
36_L	134_W	0.631	0.23
4_S	88_V	0.631	0.23
21_A	88_V	0.626	0.23
104_I	113_S	0.619	0.22
92_A	100_N	0.619	0.22
31_G	99_L	0.619	0.22
20_G	29_V	0.618	0.22
72_L	78_V	0.616	0.22
127_I	130_S	0.612	0.22
105_L	118_L	0.608	0.22
93_A	103_P	0.602	0.22
23_F	38_Q	0.599	0.21
59_C	135_L	0.598	0.21
21_A	31_G	0.597	0.21
58_V	61_G	0.597	0.21
70_L	75_W	0.596	0.21
66_H	84_A	0.595	0.21
95_L	116_I	0.587	0.21
21_A	54_I	0.587	0.21
128_A	131_L	0.580	0.21
111_L	136_Y	0.579	0.21
102_L	113_S	0.579	0.21
62_W	104_I	0.578	0.21
60_G	129_G	0.578	0.21
57_A	133_H	0.577	0.20
3_V	131_L	0.571	0.20
30_M	81_G	0.567	0.20
18_T	99_L	0.565	0.20
8_I	83_L	0.564	0.20
66_H	80_V	0.563	0.20
52_A	82_L	0.562	0.20
20_G	73_T	0.558	0.20
34_P	38_Q	0.552	0.19
12_G	91_L	0.552	0.19
110_G	119_L	0.551	0.19
29_V	51_A	0.548	0.19
37_M	80_V	0.546	0.19
10_F	119_L	0.546	0.19
86_L	127_I	0.546	0.19
132_F	135_L	0.544	0.19
71_Y	76_I	0.541	0.19
17_I	118_L	0.536	0.19
79_P	82_L	0.534	0.19
13_L	23_F	0.528	0.18
75_W	79_P	0.527	0.18
84_A	88_V	0.526	0.18
8_I	66_H	0.520	0.18
10_F	21_A	0.520	0.18
8_I	40_T	0.519	0.18
57_A	96_T	0.511	0.18
102_L	123_V	0.509	0.18
50_E	88_V	0.508	0.18
63_E	88_V	0.503	0.17
78_V	122_I	0.500	0.17
26_F	95_L	0.500	0.17

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3l1lA	2	0.6383	15.6	0.945	Contact Map
4djkA	2	0.6028	10.4	0.95	Contact Map
4huqS	1	0.6383	6.8	0.954	Contact Map
2cfqA	1	0.9291	6.6	0.954	Contact Map
2nwlA	3	0.6312	6.6	0.954	Contact Map
4hzuS	1	0.6879	5.9	0.955	Contact Map
2zy9A	2	0.9433	5.9	0.955	Contact Map
2qi9A	2	0.6312	4.4	0.957	Contact Map
2nq2A	2	0.6241	4.4	0.957	Contact Map
3giaA	1	0.6596	4.2	0.958	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0057 seconds.