YUXK - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YUXK - Uncharacterized protein YuxK

UniProt:	P40761	Sequences: MTSEQIPNRVLLFDGVCNLCNGAVQFIIKRDPDGLISFTSLQSETGQSLLKKSGLPTDRFDSFVFIEDGQVYTKSTAAIKVFRHLRGPWRLFVLFFAVPKPVRDMVYSFIAKNRYKWFGKKNECMLPSPSIKKRFLP	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	137 (129)
Sequences:	1019 (765)
Seq/√Len:	67.3

BACSU - YUXK

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
74_K	108_S	5.320	1.00
34_G	134_R	3.156	1.00
25_Q	125_M	2.767	1.00
67_E	80_K	2.766	1.00
75_S	103_R	2.576	1.00
63_F	81_V	2.510	1.00
93_V	96_F	2.180	1.00
26_F	30_R	2.127	1.00
109_F	117_W	1.995	1.00
11_L	81_V	1.957	1.00
11_L	27_I	1.916	1.00
11_L	36_I	1.906	1.00
16_V	115_Y	1.902	1.00
76_T	100_K	1.859	1.00
19_L	110_I	1.830	1.00
24_V	38_F	1.826	1.00
36_I	65_F	1.814	1.00
75_S	104_D	1.812	1.00
8_N	37_S	1.775	1.00
98_V	101_P	1.735	1.00
76_T	103_R	1.730	1.00
76_T	96_F	1.727	1.00
21_N	121_K	1.564	0.99
64_V	73_T	1.563	0.99
115_Y	119_G	1.552	0.99
65_F	80_K	1.538	0.99
35_L	84_H	1.532	0.99
105_M	109_F	1.526	0.99
49_L	66_I	1.520	0.99
125_M	131_I	1.518	0.99
47_Q	60_F	1.504	0.99
83_R	93_V	1.503	0.99
28_I	131_I	1.484	0.99
86_R	90_R	1.468	0.99
72_Y	80_K	1.468	0.99
87_G	90_R	1.449	0.98
23_A	82_F	1.416	0.98
36_I	84_H	1.410	0.98
13_F	18_N	1.386	0.98
98_V	102_V	1.383	0.98
87_G	91_L	1.355	0.97
83_R	96_F	1.345	0.97
79_I	103_R	1.314	0.97
12_L	41_L	1.300	0.97
12_L	66_I	1.276	0.96
27_I	36_I	1.258	0.96
19_L	132_K	1.258	0.96
39_T	45_T	1.256	0.96
9_R	67_E	1.201	0.95
34_G	37_S	1.176	0.94
95_F	106_V	1.169	0.94
34_G	133_K	1.147	0.94
29_K	125_M	1.145	0.93
109_F	113_N	1.144	0.93
28_I	135_F	1.132	0.93
18_N	121_K	1.126	0.93
12_L	46_G	1.111	0.92
62_S	74_K	1.087	0.92
19_L	118_F	1.086	0.92
47_Q	57_T	1.068	0.91
10_V	49_L	1.045	0.90
32_P	86_R	1.038	0.90
88_P	91_L	1.020	0.89
98_V	106_V	1.014	0.88
43_S	46_G	1.007	0.88
27_I	82_F	0.990	0.87
101_P	105_M	0.964	0.86
88_P	92_F	0.962	0.86
48_S	52_K	0.958	0.85
12_L	64_V	0.955	0.85
13_F	24_V	0.954	0.85
125_M	135_F	0.951	0.85
46_G	54_G	0.950	0.85
128_S	131_I	0.936	0.84
36_I	81_V	0.935	0.84
47_Q	51_K	0.933	0.84
78_A	82_F	0.931	0.84
10_V	67_E	0.929	0.84
49_L	53_S	0.928	0.84
64_V	136_L	0.905	0.82
129_P	133_K	0.889	0.81
115_Y	120_K	0.885	0.81
98_V	103_R	0.884	0.80
44_E	47_Q	0.879	0.80
9_R	65_F	0.877	0.80
9_R	37_S	0.866	0.79
79_I	95_F	0.861	0.79
113_N	117_W	0.859	0.79
14_D	17_C	0.856	0.78
38_F	134_R	0.856	0.78
19_L	131_I	0.845	0.77
9_R	84_H	0.844	0.77
18_N	24_V	0.838	0.77
55_L	60_F	0.828	0.76
46_G	55_L	0.825	0.76
115_Y	118_F	0.819	0.75
12_L	51_K	0.811	0.74
25_Q	29_K	0.800	0.73
79_I	93_V	0.799	0.73
9_R	35_L	0.797	0.73
26_F	89_W	0.787	0.72
14_D	20_C	0.785	0.72
65_F	84_H	0.783	0.72
45_T	48_S	0.782	0.72
10_V	45_T	0.775	0.71
106_V	110_I	0.763	0.70
40_S	43_S	0.757	0.69
18_N	21_N	0.752	0.69
95_F	98_V	0.750	0.69
79_I	106_V	0.745	0.68
46_G	51_K	0.739	0.67
25_Q	131_I	0.738	0.67
31_D	86_R	0.727	0.66
76_T	80_K	0.722	0.66
65_F	135_F	0.719	0.65
16_V	122_N	0.719	0.65
38_F	63_F	0.709	0.64
102_V	105_M	0.707	0.64
17_C	20_C	0.706	0.64
67_E	84_H	0.706	0.64
37_S	49_L	0.704	0.64
29_K	32_P	0.692	0.62
21_N	25_Q	0.685	0.62
126_L	131_I	0.683	0.61
31_D	36_I	0.682	0.61
80_K	83_R	0.676	0.60
83_R	91_L	0.673	0.60
57_T	60_F	0.670	0.60
11_L	42_Q	0.666	0.59
80_K	93_V	0.658	0.58
11_L	31_D	0.656	0.58
12_L	63_F	0.653	0.58
15_G	24_V	0.652	0.58
12_L	39_T	0.651	0.58
128_S	132_K	0.645	0.57
46_G	113_N	0.645	0.57
53_S	71_V	0.636	0.56
53_S	66_I	0.633	0.56
86_R	91_L	0.633	0.56
63_F	78_A	0.627	0.55
76_T	79_I	0.627	0.55
31_D	34_G	0.626	0.55
12_L	43_S	0.623	0.54
23_A	63_F	0.615	0.53
13_F	62_S	0.609	0.53
39_T	43_S	0.599	0.51
25_Q	30_R	0.594	0.51
109_F	112_K	0.593	0.51
46_G	49_L	0.592	0.51
111_A	115_Y	0.584	0.50
23_A	27_I	0.582	0.49
24_V	135_F	0.580	0.49
94_L	101_P	0.580	0.49
79_I	121_K	0.580	0.49
36_I	53_S	0.579	0.49
61_D	78_A	0.579	0.49
70_Q	101_P	0.578	0.49
105_M	112_K	0.575	0.49
54_G	86_R	0.570	0.48
90_R	93_V	0.569	0.48
18_N	117_W	0.563	0.47
60_F	63_F	0.561	0.47
27_I	81_V	0.560	0.47
33_D	86_R	0.551	0.46
34_G	131_I	0.549	0.46
18_N	41_L	0.547	0.45
52_K	66_I	0.539	0.44
70_Q	83_R	0.537	0.44
97_A	102_V	0.536	0.44
50_L	60_F	0.534	0.44
19_L	117_W	0.533	0.44
37_S	57_T	0.533	0.44
74_K	104_D	0.532	0.44
38_F	131_I	0.532	0.44
75_S	79_I	0.530	0.43
48_S	51_K	0.530	0.43
41_L	64_V	0.528	0.43
30_R	89_W	0.527	0.43
95_F	126_L	0.526	0.43
101_P	108_S	0.523	0.43
19_L	119_G	0.519	0.42
29_K	105_M	0.519	0.42
8_N	34_G	0.519	0.42
24_V	63_F	0.517	0.42
43_S	75_S	0.516	0.42
63_F	75_S	0.514	0.41
49_L	69_G	0.514	0.41
66_I	71_V	0.510	0.41
118_F	136_L	0.508	0.41
26_F	98_V	0.508	0.41
124_C	127_P	0.505	0.40
12_L	75_S	0.504	0.40
33_D	70_Q	0.503	0.40
40_S	46_G	0.500	0.40

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4o32A	1	0.5912	76.8	0.915	Contact Map
2vimA	1	0.6131	74.6	0.916	Contact Map
2j23A	1	0.6569	72.4	0.918	Contact Map
2oe3A	2	0.6058	70.2	0.919	Contact Map
3f3qA	1	0.6496	69.6	0.919	Contact Map
1gh2A	1	0.6204	68.7	0.92	Contact Map
2fwhA	1	0.6058	68.6	0.92	Contact Map
2pptA	2	0.6642	67.6	0.92	Contact Map
1w4vA	2	0.6204	67.1	0.92	Contact Map
1zmaA	1	0.5985	65.6	0.921	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0064 seconds.