CHED - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

CHED - Chemoreceptor glutamine deamidase CheD

UniProt:	P40404	Sequences: MSTTEAVVIKVGIADVKIARFPDTIRTSGLGSCVGLVLYDKEKQTAGLVHVMLPDSTLSKTAELNRAKYADTAVQTTIDMLIEAGCRKFALKAKLAGGSEMFKFKSTNDLMKIGPRNVLAIKEQLSLFNIPIISEDTGGSSGRTIEFEPKSCMLHIRTVKQGEKTI	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	166 (147)
Sequences:	1466 (1123)
Seq/√Len:	92.6

BACSU - CHED
HALSA - Q9HQW9

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
122_K	135_E	5.443	1.00
49_V	73_A	3.699	1.00
81_L	86_C	3.463	1.00
93_A	130_I	3.170	1.00
118_V	137_T	2.829	1.00
51_V	70_A	2.776	1.00
38_L	93_A	2.373	1.00
145_I	154_L	2.345	1.00
41_K	92_K	2.124	1.00
95_L	121_I	2.123	1.00
51_V	121_I	2.118	1.00
80_M	83_E	1.996	1.00
34_V	118_V	1.971	1.00
66_R	76_T	1.914	1.00
18_I	84_A	1.906	1.00
123_E	127_L	1.864	1.00
39_Y	92_K	1.864	1.00
100_E	112_K	1.827	1.00
112_K	115_P	1.825	1.00
46_A	149_P	1.811	1.00
95_L	132_I	1.777	1.00
37_V	48_L	1.748	1.00
82_I	88_K	1.739	1.00
94_K	134_S	1.660	1.00
40_D	90_A	1.592	1.00
92_K	133_I	1.579	1.00
42_E	90_A	1.575	1.00
47_G	77_T	1.571	1.00
43_K	90_A	1.547	1.00
16_V	77_T	1.519	1.00
136_D	158_T	1.504	1.00
70_A	121_I	1.499	1.00
38_L	130_I	1.488	1.00
74_V	124_Q	1.447	1.00
19_A	46_A	1.443	0.99
39_Y	147_F	1.362	0.99
70_A	120_A	1.328	0.99
78_I	128_F	1.323	0.99
75_Q	79_D	1.312	0.99
75_Q	124_Q	1.290	0.99
46_A	152_C	1.288	0.99
79_D	83_E	1.282	0.99
88_K	128_F	1.278	0.99
34_V	137_T	1.259	0.99
81_L	91_L	1.244	0.98
93_A	125_L	1.237	0.98
125_L	130_I	1.231	0.98
87_R	90_A	1.229	0.98
41_K	90_A	1.220	0.98
39_Y	44_Q	1.219	0.98
118_V	138_G	1.198	0.98
119_L	123_E	1.183	0.98
148_E	153_M	1.182	0.98
18_I	45_T	1.175	0.98
115_P	119_L	1.173	0.98
120_A	124_Q	1.171	0.98
19_A	23_D	1.163	0.98
38_L	91_L	1.163	0.98
136_D	156_I	1.159	0.98
24_T	148_E	1.122	0.97
26_R	146_E	1.117	0.97
79_D	128_F	1.114	0.97
96_A	154_L	1.098	0.97
76_T	79_D	1.098	0.97
148_E	151_S	1.095	0.97
37_V	147_F	1.094	0.97
93_A	131_P	1.093	0.97
75_Q	128_F	1.092	0.97
95_L	137_T	1.076	0.96
16_V	80_M	1.066	0.96
86_C	91_L	1.062	0.96
109_D	112_K	1.061	0.96
46_A	147_F	1.058	0.96
56_S	72_T	1.057	0.96
67_A	76_T	1.040	0.95
37_V	152_C	1.033	0.95
76_T	80_M	1.023	0.95
124_Q	128_F	1.021	0.95
95_L	122_K	1.016	0.95
49_V	70_A	1.008	0.95
122_K	137_T	1.008	0.95
24_T	146_E	1.000	0.94
122_K	132_I	0.995	0.94
56_S	71_D	0.987	0.94
82_I	91_L	0.984	0.94
145_I	156_I	0.974	0.94
40_D	86_C	0.962	0.93
148_E	155_H	0.957	0.93
41_K	152_C	0.956	0.93
35_G	145_I	0.952	0.93
123_E	126_S	0.926	0.92
8_V	24_T	0.915	0.91
79_D	82_I	0.894	0.90
34_V	70_A	0.887	0.90
17_K	80_M	0.886	0.90
46_A	81_L	0.884	0.90
78_I	91_L	0.880	0.90
146_E	154_L	0.875	0.89
80_M	84_A	0.873	0.89
20_R	84_A	0.858	0.88
8_V	26_R	0.857	0.88
96_A	145_I	0.852	0.88
28_S	160_K	0.845	0.88
86_C	90_A	0.843	0.87
95_L	135_E	0.840	0.87
16_V	76_T	0.829	0.87
19_A	149_P	0.826	0.86
43_K	46_A	0.817	0.86
22_P	150_K	0.810	0.85
11_V	48_L	0.810	0.85
130_I	133_I	0.808	0.85
11_V	144_T	0.805	0.85
124_Q	127_L	0.805	0.85
42_E	87_R	0.804	0.85
56_S	60_K	0.797	0.84
116_R	119_L	0.794	0.84
37_V	92_K	0.793	0.84
96_A	156_I	0.784	0.83
71_D	124_Q	0.784	0.83
45_T	86_C	0.782	0.83
100_E	111_M	0.755	0.81
49_V	74_V	0.744	0.80
36_L	95_L	0.732	0.79
13_I	49_V	0.729	0.79
19_A	25_I	0.727	0.78
36_L	121_I	0.719	0.78
28_S	73_A	0.709	0.77
11_V	17_K	0.706	0.76
36_L	51_V	0.706	0.76
98_G	114_G	0.706	0.76
81_L	149_P	0.699	0.76
55_D	71_D	0.698	0.76
44_Q	150_K	0.697	0.76
55_D	101_M	0.692	0.75
49_V	77_T	0.690	0.75
17_K	25_I	0.683	0.74
51_V	74_V	0.676	0.73
20_R	23_D	0.674	0.73
59_S	109_D	0.673	0.73
92_K	131_P	0.673	0.73
136_D	143_R	0.673	0.73
146_E	155_H	0.671	0.73
13_I	51_V	0.670	0.73
92_K	147_F	0.669	0.73
100_E	115_P	0.667	0.72
141_S	158_T	0.667	0.72
25_I	48_L	0.663	0.72
82_I	87_R	0.660	0.71
12_G	142_G	0.649	0.70
144_T	157_R	0.647	0.70
32_S	117_N	0.639	0.69
47_G	86_C	0.635	0.69
16_V	67_A	0.635	0.69
72_T	76_T	0.632	0.68
125_L	131_P	0.625	0.67
59_S	145_I	0.624	0.67
13_I	28_S	0.624	0.67
89_F	127_L	0.622	0.67
100_E	139_G	0.617	0.66
11_V	146_E	0.613	0.66
103_K	111_M	0.611	0.66
37_V	49_V	0.610	0.65
55_D	58_L	0.608	0.65
141_S	159_V	0.607	0.65
99_S	141_S	0.600	0.64
53_L	68_K	0.600	0.64
147_F	154_L	0.597	0.64
25_I	149_P	0.596	0.64
39_Y	133_I	0.595	0.64
67_A	73_A	0.594	0.63
70_A	77_T	0.593	0.63
13_I	27_T	0.589	0.63
18_I	77_T	0.581	0.62
40_D	85_G	0.580	0.62
30_L	35_G	0.580	0.62
8_V	145_I	0.579	0.61
45_T	84_A	0.577	0.61
37_V	154_L	0.576	0.61
34_V	51_V	0.572	0.61
88_K	126_S	0.570	0.60
42_E	89_F	0.567	0.60
48_L	145_I	0.566	0.60
68_K	142_G	0.561	0.59
77_T	85_G	0.558	0.59
17_K	35_G	0.556	0.58
93_A	133_I	0.554	0.58
75_Q	147_F	0.553	0.58
94_K	154_L	0.549	0.57
123_E	131_P	0.546	0.57
20_R	45_T	0.544	0.57
54_P	116_R	0.540	0.56
14_A	112_K	0.531	0.55
57_T	69_Y	0.530	0.55
21_F	110_L	0.526	0.54
13_I	52_M	0.525	0.54
119_L	126_S	0.525	0.54
125_L	132_I	0.525	0.54
92_K	152_C	0.524	0.54
14_A	104_F	0.522	0.54
47_G	128_F	0.522	0.54
52_M	71_D	0.522	0.54
9_I	23_D	0.521	0.54
58_L	63_E	0.516	0.53
54_P	118_V	0.516	0.53
8_V	146_E	0.515	0.53
40_D	47_G	0.514	0.53
15_D	27_T	0.512	0.52
83_E	110_L	0.511	0.52
79_D	88_K	0.511	0.52
41_K	149_P	0.511	0.52
35_G	96_A	0.509	0.52
18_I	81_L	0.509	0.52
74_V	120_A	0.507	0.52
25_I	86_C	0.505	0.51
141_S	160_K	0.504	0.51
42_E	123_E	0.503	0.51
52_M	113_I	0.502	0.51
78_I	130_I	0.502	0.51
30_L	53_L	0.501	0.51
75_Q	78_I	0.500	0.51

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2f9zC	1	0.9036	100	0.088	Contact Map
1xfjA	1	0.8735	20.9	0.944	Contact Map
3al5A	2	0.5663	16.7	0.946	Contact Map
3g3tA	1	0.3614	15.1	0.947	Contact Map
3ba3A	2	0.3072	12.8	0.949	Contact Map
2nu8B	2	0.8494	11.8	0.95	Contact Map
4o1jA	4	0.8976	11.7	0.95	Contact Map
1t8hA	1	0.8373	11.4	0.95	Contact Map
1c1yB	1	0.4578	10.6	0.951	Contact Map
3v4cA	2	0.241	9.8	0.952	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0062 seconds.