CHEC - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

CHEC - CheY-P phosphatase CheC

UniProt:	P40403	Sequences: MSIFNGIKEEQMDILREVGNIGAGHSASAMAQLLNRKIDMEVPFAKLLSFDELVDFFGGADVPVASIFLRMEGDLTGSMFFIMPFFQAEQFIRELIGNPDFDIEDLGEDHMSSSALHELGNILAGSYLTALADLTKLQLYPSVPEVSLDMFGAVISEGLMELSQVGEHAIVVDTSIFDQSHQQELKAHMFMLPDYDSFEKLFVALGASL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	209 (192)
Sequences:	1502 (1220)
Seq/√Len:	88.1

BACSU - CHEC
HALSA - F2Z5Y8 Q9HPJ6 Q9HQW8

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
144_P	149_D	4.982	1.00
8_K	11_Q	4.681	1.00
36_R	94_E	4.222	1.00
146_V	149_D	3.896	1.00
141_P	146_V	3.309	1.00
146_V	151_F	3.296	1.00
141_P	149_D	3.149	1.00
109_D	112_S	3.141	1.00
64_V	82_I	3.055	1.00
17_E	20_N	2.716	1.00
149_D	153_A	2.666	1.00
114_S	118_E	2.643	1.00
118_E	122_I	2.354	1.00
71_M	75_L	2.315	1.00
20_N	43_P	2.306	1.00
141_P	144_P	2.286	1.00
151_F	154_V	2.210	1.00
20_N	24_G	2.195	1.00
27_A	198_F	2.026	1.00
114_S	121_N	2.024	1.00
144_P	154_V	1.914	1.00
118_E	121_N	1.895	1.00
193_P	197_S	1.885	1.00
128_L	131_L	1.875	1.00
75_L	201_L	1.848	1.00
120_G	125_G	1.817	1.00
68_F	78_S	1.800	1.00
166_G	169_A	1.741	1.00
71_M	191_M	1.690	1.00
121_N	126_S	1.632	1.00
125_G	129_T	1.605	1.00
144_P	150_M	1.569	1.00
129_T	133_D	1.568	1.00
147_S	152_G	1.549	1.00
123_L	126_S	1.533	1.00
121_N	128_L	1.506	1.00
40_M	43_P	1.475	0.99
37_K	91_F	1.453	0.99
122_I	135_T	1.447	0.99
121_N	135_T	1.390	0.99
17_E	24_G	1.383	0.99
70_R	142_S	1.372	0.99
168_H	201_L	1.367	0.99
53_L	78_S	1.357	0.99
115_A	121_N	1.313	0.99
71_M	77_G	1.305	0.99
30_M	33_L	1.292	0.99
168_H	172_V	1.286	0.99
77_G	172_V	1.277	0.98
17_E	21_I	1.265	0.98
118_E	135_T	1.255	0.98
38_I	190_F	1.255	0.98
24_G	28_S	1.252	0.98
93_R	103_I	1.233	0.98
114_S	127_Y	1.229	0.98
118_E	125_G	1.218	0.98
200_K	203_V	1.208	0.98
140_Y	146_V	1.182	0.98
124_A	127_Y	1.179	0.97
27_A	84_P	1.179	0.97
188_H	197_S	1.176	0.97
19_G	172_V	1.171	0.97
13_D	21_I	1.165	0.97
81_F	187_A	1.165	0.97
28_S	32_Q	1.152	0.97
92_I	95_L	1.120	0.97
82_I	94_E	1.117	0.96
122_I	128_L	1.116	0.96
144_P	151_F	1.110	0.96
121_N	125_G	1.100	0.96
122_I	131_L	1.096	0.96
118_E	127_Y	1.091	0.96
31_A	96_I	1.083	0.96
111_M	114_S	1.077	0.96
40_M	67_I	1.073	0.96
46_K	86_F	1.073	0.96
24_G	43_P	1.070	0.96
118_E	126_S	1.064	0.95
128_L	141_P	1.053	0.95
23_A	31_A	1.050	0.95
16_R	198_F	1.033	0.95
65_A	88_A	1.025	0.94
57_F	83_M	1.021	0.94
36_R	179_Q	1.016	0.94
69_L	169_A	1.005	0.94
19_G	22_G	1.004	0.94
41_E	175_S	0.998	0.93
144_P	147_S	0.994	0.93
111_M	122_I	0.977	0.93
82_I	191_M	0.976	0.93
126_S	131_L	0.976	0.93
31_A	50_F	0.975	0.93
33_L	97_G	0.971	0.93
128_L	134_L	0.965	0.92
93_R	101_F	0.959	0.92
116_L	122_I	0.956	0.92
121_N	129_T	0.952	0.92
114_S	129_T	0.949	0.92
23_A	40_M	0.943	0.91
122_I	127_Y	0.939	0.91
30_M	78_S	0.936	0.91
111_M	119_L	0.932	0.91
95_L	119_L	0.931	0.91
150_M	153_A	0.928	0.91
28_S	40_M	0.926	0.91
134_L	159_L	0.923	0.91
169_A	173_D	0.915	0.90
171_V	200_K	0.901	0.89
80_F	158_G	0.898	0.89
108_E	114_S	0.897	0.89
111_M	118_E	0.894	0.89
119_L	122_I	0.891	0.89
8_K	68_F	0.889	0.89
91_F	179_Q	0.884	0.89
10_E	27_A	0.882	0.88
169_A	178_D	0.875	0.88
27_A	96_I	0.875	0.88
118_E	123_L	0.872	0.88
38_I	45_A	0.870	0.88
182_Q	200_K	0.860	0.87
165_V	201_L	0.855	0.87
118_E	144_P	0.841	0.86
178_D	196_D	0.839	0.86
11_Q	87_Q	0.837	0.86
121_N	127_Y	0.833	0.85
33_L	50_F	0.831	0.85
115_A	118_E	0.827	0.85
8_K	48_L	0.821	0.85
177_F	184_E	0.819	0.84
79_M	124_A	0.818	0.84
130_A	134_L	0.808	0.84
83_M	91_F	0.805	0.83
178_D	190_F	0.800	0.83
53_L	58_G	0.799	0.83
179_Q	182_Q	0.798	0.83
35_N	61_D	0.796	0.83
74_D	137_L	0.795	0.83
70_R	78_S	0.794	0.83
18_V	66_S	0.794	0.83
126_S	144_P	0.793	0.82
123_L	201_L	0.791	0.82
123_L	130_A	0.781	0.81
110_H	122_I	0.777	0.81
144_P	155_I	0.776	0.81
21_I	24_G	0.774	0.81
114_S	193_P	0.774	0.81
11_Q	175_S	0.769	0.80
91_F	122_I	0.765	0.80
114_S	132_A	0.764	0.80
111_M	120_G	0.763	0.80
48_L	72_E	0.762	0.80
69_L	78_S	0.760	0.80
10_E	194_D	0.759	0.80
52_E	55_D	0.758	0.80
118_E	129_T	0.756	0.79
76_T	196_D	0.755	0.79
27_A	38_I	0.754	0.79
116_L	120_G	0.752	0.79
147_S	150_M	0.748	0.79
101_F	110_H	0.748	0.79
121_N	134_L	0.748	0.79
86_F	91_F	0.748	0.79
143_V	174_T	0.746	0.78
17_E	43_P	0.740	0.78
122_I	126_S	0.737	0.78
127_Y	135_T	0.736	0.78
76_T	80_F	0.731	0.77
108_E	118_E	0.730	0.77
18_V	42_V	0.726	0.77
88_A	169_A	0.726	0.77
117_H	198_F	0.724	0.76
92_I	96_I	0.719	0.76
146_V	155_I	0.709	0.75
159_L	162_L	0.709	0.75
32_Q	203_V	0.709	0.75
29_A	33_L	0.707	0.75
50_F	135_T	0.705	0.74
13_D	40_M	0.702	0.74
109_D	116_L	0.699	0.74
155_I	159_L	0.699	0.74
144_P	148_L	0.698	0.74
14_I	28_S	0.696	0.73
149_D	154_V	0.694	0.73
127_Y	130_A	0.693	0.73
120_G	132_A	0.691	0.73
115_A	126_S	0.691	0.73
110_H	121_N	0.688	0.73
190_F	193_P	0.687	0.73
22_G	192_L	0.684	0.72
112_S	118_E	0.682	0.72
7_I	102_D	0.681	0.72
71_M	165_V	0.679	0.72
66_S	154_V	0.678	0.72
196_D	201_L	0.678	0.72
34_L	192_L	0.674	0.71
103_I	109_D	0.674	0.71
109_D	119_L	0.670	0.71
46_K	80_F	0.666	0.70
166_G	170_I	0.664	0.70
127_Y	131_L	0.664	0.70
22_G	202_F	0.662	0.70
14_I	196_D	0.659	0.69
14_I	198_F	0.658	0.69
46_K	56_F	0.657	0.69
28_S	31_A	0.657	0.69
58_G	61_D	0.654	0.69
48_L	52_E	0.640	0.67
121_N	124_A	0.637	0.67
64_V	151_F	0.637	0.67
100_D	110_H	0.635	0.67
70_R	147_S	0.632	0.66
26_S	72_E	0.630	0.66
82_I	87_Q	0.630	0.66
58_G	152_G	0.627	0.66
111_M	116_L	0.626	0.65
139_L	149_D	0.624	0.65
159_L	170_I	0.623	0.65
108_E	117_H	0.623	0.65
15_L	172_V	0.618	0.64
92_I	197_S	0.617	0.64
121_N	133_D	0.615	0.64
42_V	81_F	0.615	0.64
86_F	196_D	0.611	0.64
56_F	83_M	0.611	0.64
109_D	123_L	0.610	0.63
7_I	12_M	0.609	0.63
162_L	170_I	0.608	0.63
113_S	117_H	0.607	0.63
87_Q	91_F	0.605	0.63
114_S	122_I	0.602	0.62
165_V	179_Q	0.600	0.62
165_V	203_V	0.598	0.62
174_T	190_F	0.596	0.62
120_G	123_L	0.596	0.62
146_V	152_G	0.589	0.61
89_E	103_I	0.588	0.61
21_I	25_H	0.587	0.61
84_P	171_V	0.582	0.60
167_E	170_I	0.580	0.60
100_D	133_D	0.580	0.60
44_F	173_D	0.579	0.59
93_R	112_S	0.575	0.59
9_E	199_E	0.571	0.58
63_P	99_P	0.571	0.58
115_A	119_L	0.570	0.58
38_I	145_E	0.569	0.58
141_P	148_L	0.568	0.58
50_F	58_G	0.568	0.58
134_L	154_V	0.562	0.57
121_N	144_P	0.562	0.57
40_M	81_F	0.561	0.57
35_N	99_P	0.559	0.57
9_E	111_M	0.557	0.57
126_S	133_D	0.556	0.56
63_P	165_V	0.553	0.56
109_D	113_S	0.553	0.56
118_E	133_D	0.551	0.56
49_S	203_V	0.546	0.55
71_M	171_V	0.545	0.55
123_L	139_L	0.542	0.55
63_P	182_Q	0.542	0.55
39_D	186_K	0.542	0.55
24_G	67_I	0.542	0.55
103_I	112_S	0.537	0.54
111_M	125_G	0.537	0.54
174_T	187_A	0.536	0.54
83_M	195_Y	0.533	0.53
122_I	132_A	0.532	0.53
85_F	88_A	0.527	0.52
124_A	133_D	0.525	0.52
23_A	95_L	0.525	0.52
114_S	128_L	0.520	0.52
100_D	160_M	0.519	0.51
74_D	196_D	0.519	0.51
139_L	146_V	0.516	0.51
69_L	85_F	0.516	0.51
35_N	184_E	0.512	0.50
60_A	165_V	0.511	0.50
41_E	196_D	0.511	0.50
13_D	16_R	0.510	0.50
183_Q	201_L	0.510	0.50
122_I	133_D	0.510	0.50
132_A	139_L	0.510	0.50
23_A	174_T	0.508	0.50
23_A	193_P	0.507	0.50
110_H	114_S	0.506	0.50
132_A	144_P	0.502	0.49
89_E	108_E	0.500	0.49

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3qtaA	2	0.9474	100	0.286	Contact Map
1xkrA	1	0.9617	100	0.329	Contact Map
4hynA	1	0.9426	100	0.423	Contact Map
4fhrA	1	0.8708	100	0.445	Contact Map
4gc8A	1	0.8756	99.9	0.466	Contact Map
1squA	2	0.7321	99.8	0.59	Contact Map
3hm4A	2	0.7321	99.8	0.593	Contact Map
3h2dA	2	0.7321	99.8	0.596	Contact Map
3hzhB	1	0.7321	99.7	0.625	Contact Map
3uswA	1	0.6507	49.1	0.924	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0075 seconds.