YTXJ - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YTXJ - Uncharacterized protein YtxJ

UniProt:	P39914	Sequences: MAKQLIQSEEEFKRIAEQEGVFVFLKHSTTCPISQAAFHEFDAFANQHEDVPAYYLQVQEARPLSNFIAETYGVKHESPQIFIIQNGEVKWHTSHSQITEAAIEQHLS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	108 (103)
Sequences:	479 (387)
Seq/√Len:	38.1

BACSU - YTXJ

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
82_F	89_V	4.400	1.00
89_V	92_H	3.894	1.00
67_F	71_T	3.745	1.00
30_T	59_Q	3.677	1.00
20_G	52_P	3.152	1.00
56_L	68_I	2.581	1.00
23_V	83_I	2.126	0.99
38_F	42_D	2.086	0.99
12_F	24_F	2.048	0.99
18_Q	52_P	2.011	0.99
22_F	52_P	1.936	0.98
64_L	68_I	1.736	0.97
9_E	64_L	1.662	0.96
5_L	55_Y	1.649	0.96
29_T	57_Q	1.643	0.95
38_F	55_Y	1.640	0.95
9_E	67_F	1.607	0.95
9_E	63_P	1.568	0.94
21_V	85_Q	1.560	0.94
74_V	92_H	1.545	0.94
102_A	105_Q	1.518	0.93
12_F	71_T	1.510	0.93
4_Q	52_P	1.489	0.92
58_V	61_A	1.465	0.92
11_E	14_R	1.380	0.89
7_Q	11_E	1.373	0.89
57_Q	61_A	1.337	0.88
13_K	71_T	1.326	0.87
32_P	40_E	1.320	0.87
25_L	38_F	1.308	0.86
23_V	51_V	1.296	0.86
16_A	72_Y	1.289	0.86
56_L	59_Q	1.285	0.85
41_F	53_A	1.248	0.84
93_T	97_Q	1.228	0.83
25_L	29_T	1.214	0.82
56_L	64_L	1.209	0.82
27_H	57_Q	1.206	0.81
72_Y	87_G	1.204	0.81
5_L	57_Q	1.203	0.81
81_I	103_I	1.203	0.81
15_I	24_F	1.201	0.81
16_A	71_T	1.199	0.81
15_I	22_F	1.168	0.79
45_A	99_T	1.132	0.77
30_T	75_K	1.104	0.75
47_Q	100_E	1.072	0.73
85_Q	90_K	1.068	0.73
68_I	83_I	1.058	0.72
83_I	102_A	1.057	0.72
3_K	38_F	1.047	0.71
43_A	100_E	1.039	0.71
46_N	104_E	1.035	0.70
15_I	54_Y	1.011	0.69
9_E	13_K	1.003	0.68
32_P	37_A	0.989	0.67
29_T	59_Q	0.985	0.67
11_E	85_Q	0.958	0.64
58_V	91_W	0.950	0.64
74_V	77_E	0.948	0.64
11_E	18_Q	0.926	0.62
81_I	93_T	0.918	0.61
57_Q	60_E	0.915	0.61
29_T	64_L	0.894	0.59
8_S	64_L	0.878	0.58
37_A	91_W	0.874	0.57
60_E	73_G	0.852	0.55
38_F	58_V	0.837	0.54
91_W	99_T	0.800	0.51
52_P	59_Q	0.793	0.50
81_I	105_Q	0.778	0.49
35_Q	45_A	0.777	0.49
52_P	105_Q	0.775	0.48
40_E	103_I	0.764	0.47
25_L	41_F	0.752	0.46
12_F	58_V	0.748	0.46
28_S	94_S	0.740	0.45
5_L	81_I	0.732	0.45
49_E	104_E	0.729	0.44
19_E	70_E	0.728	0.44
53_A	72_Y	0.725	0.44
78_S	98_I	0.722	0.44
36_A	96_S	0.721	0.44
12_F	56_L	0.710	0.43
11_E	15_I	0.708	0.42
32_P	45_A	0.698	0.42
37_A	83_I	0.696	0.41
69_A	93_T	0.694	0.41
7_Q	35_Q	0.693	0.41
32_P	35_Q	0.692	0.41
81_I	102_A	0.686	0.41
23_V	81_I	0.681	0.40
73_G	105_Q	0.669	0.39
91_W	96_S	0.662	0.38
71_T	86_N	0.655	0.38
22_F	84_I	0.651	0.38
30_T	77_E	0.648	0.37
4_Q	100_E	0.647	0.37
3_K	57_Q	0.646	0.37
73_G	88_E	0.636	0.36
6_I	22_F	0.636	0.36
50_D	81_I	0.635	0.36
44_F	58_V	0.632	0.36
28_S	34_S	0.631	0.36
49_E	82_F	0.625	0.35
33_I	103_I	0.620	0.35
39_H	97_Q	0.617	0.35
21_V	84_I	0.610	0.34
11_E	45_A	0.607	0.34
14_R	18_Q	0.603	0.34
30_T	60_E	0.601	0.33
21_V	83_I	0.599	0.33
40_E	58_V	0.598	0.33
101_A	104_E	0.595	0.33
22_F	38_F	0.593	0.33
67_F	70_E	0.582	0.32
14_R	88_E	0.580	0.32
29_T	66_N	0.577	0.32
70_E	75_K	0.575	0.31
56_L	66_N	0.569	0.31
17_E	86_N	0.569	0.31
42_D	63_P	0.566	0.31
20_G	49_E	0.566	0.31
59_Q	64_L	0.565	0.31
5_L	49_E	0.561	0.30
30_T	33_I	0.560	0.30
9_E	47_Q	0.559	0.30
12_F	29_T	0.557	0.30
10_E	52_P	0.555	0.30
50_D	93_T	0.551	0.30
44_F	83_I	0.550	0.30
14_R	51_V	0.548	0.29
47_Q	63_P	0.547	0.29
93_T	105_Q	0.546	0.29
41_F	84_I	0.544	0.29
8_S	90_K	0.541	0.29
27_H	94_S	0.541	0.29
11_E	88_E	0.538	0.29
21_V	50_D	0.535	0.28
75_K	91_W	0.526	0.28
28_S	62_R	0.520	0.27
82_F	90_K	0.518	0.27
56_L	61_A	0.518	0.27
4_Q	86_N	0.516	0.27
16_A	87_G	0.516	0.27
53_A	74_V	0.512	0.27
15_I	98_I	0.510	0.27
41_F	81_I	0.508	0.26
30_T	96_S	0.508	0.26
32_P	92_H	0.505	0.26
72_Y	84_I	0.503	0.26
9_E	105_Q	0.502	0.26
3_K	36_A	0.502	0.26
25_L	84_I	0.500	0.26

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3iv4A	1	0.9907	99.5	0.66	Contact Map
4cw9A	2	0.9259	98.7	0.765	Contact Map
1gh2A	1	0.9352	98.6	0.768	Contact Map
2j23A	1	0.9352	98.6	0.772	Contact Map
4euyA	1	0.7685	98.6	0.773	Contact Map
1r26A	1	0.9352	98.6	0.773	Contact Map
2wz9A	1	0.9352	98.5	0.777	Contact Map
1xflA	1	0.9352	98.5	0.779	Contact Map
1ep7A	1	0.9352	98.5	0.78	Contact Map
4i8bA	2	0.9259	98.5	0.78	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0053 seconds.