BLTD - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

BLTD - Spermine/spermidine acetyltransferase

UniProt:	P39909	Sequences: MSINIKAVTDDNRAAILDLHVSQNQLSYIESTKVCLEDAKECHYYKPVGLYYEGDLVGFAMYGLFPEYDEDNKNGRVWLDRFFIDERYQGKGLGKKMLKALIQHLAELYKCKRIYLSIFENNIHAIRLYQRFGFQFNGELDFNGEKVMVKEL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	152 (140)
Sequences:	1305 (995)
Seq/√Len:	84.1

BACSU - BLTD YBBJ

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
32_T	83_F	3.309	1.00
50_L	97_M	3.167	1.00
95_K	131_R	3.164	1.00
118_I	148_M	3.049	1.00
52_Y	93_L	2.658	1.00
25_Q	89_Q	2.629	1.00
47_P	59_F	2.547	1.00
23_Q	26_L	2.503	1.00
16_I	49_G	2.472	1.00
60_A	101_L	2.405	1.00
58_G	84_I	2.355	1.00
16_I	56_L	2.336	1.00
6_K	51_Y	2.321	1.00
51_Y	56_L	2.319	1.00
55_D	88_Y	2.273	1.00
22_S	86_E	2.187	1.00
37_E	41_E	2.162	1.00
122_N	125_A	1.941	1.00
57_V	93_L	1.876	1.00
88_Y	91_K	1.848	1.00
20_H	86_E	1.831	1.00
84_I	93_L	1.766	1.00
118_I	126_I	1.744	1.00
48_V	104_H	1.643	1.00
126_I	130_Q	1.631	1.00
98_L	132_F	1.627	1.00
30_E	81_R	1.567	1.00
50_L	58_G	1.566	1.00
35_C	61_M	1.535	1.00
39_A	47_P	1.516	0.99
35_C	81_R	1.482	0.99
79_L	116_L	1.429	0.99
19_L	83_F	1.423	0.99
125_A	129_Y	1.405	0.99
4_N	54_G	1.400	0.99
32_T	35_C	1.359	0.99
139_E	147_V	1.351	0.99
109_Y	118_I	1.334	0.99
21_V	25_Q	1.325	0.99
126_I	136_F	1.298	0.98
48_V	62_Y	1.295	0.98
117_S	141_D	1.259	0.98
82_F	98_L	1.250	0.98
95_K	99_K	1.235	0.98
8_V	49_G	1.234	0.98
45_Y	80_D	1.213	0.98
38_D	81_R	1.203	0.97
13_R	17_L	1.201	0.97
116_L	129_Y	1.196	0.97
51_Y	54_G	1.180	0.97
96_K	99_K	1.176	0.97
63_G	78_W	1.176	0.97
32_T	81_R	1.161	0.97
35_C	59_F	1.156	0.97
125_A	128_L	1.148	0.97
76_R	113_R	1.120	0.96
45_Y	63_G	1.115	0.96
130_Q	136_F	1.113	0.96
57_V	88_Y	1.107	0.96
13_R	41_E	1.094	0.95
9_T	12_N	1.079	0.95
102_I	114_I	1.077	0.95
116_L	125_A	1.062	0.95
103_Q	106_A	1.042	0.94
17_L	33_K	1.040	0.94
102_I	106_A	1.040	0.94
50_L	84_I	1.036	0.94
100_A	103_Q	1.035	0.94
6_K	12_N	1.032	0.94
130_Q	148_M	1.026	0.94
12_N	51_Y	1.021	0.93
57_V	97_M	1.019	0.93
79_L	98_L	1.018	0.93
77_V	111_C	1.016	0.93
29_I	83_F	1.005	0.93
10_D	43_H	0.994	0.93
111_C	114_I	0.991	0.92
136_F	148_M	0.981	0.92
99_K	103_Q	0.965	0.91
3_I	52_Y	0.959	0.91
5_I	50_L	0.958	0.91
78_W	115_Y	0.956	0.91
122_N	128_L	0.950	0.91
79_L	132_F	0.941	0.90
49_G	56_L	0.940	0.90
30_E	80_D	0.939	0.90
95_K	128_L	0.933	0.90
35_C	83_F	0.924	0.89
128_L	132_F	0.907	0.89
61_M	80_D	0.904	0.88
126_I	148_M	0.898	0.88
127_R	130_Q	0.898	0.88
14_A	34_V	0.895	0.88
75_G	112_K	0.885	0.87
15_A	55_D	0.871	0.87
5_I	97_M	0.862	0.86
61_M	81_R	0.859	0.86
101_L	105_L	0.849	0.85
53_E	107_E	0.843	0.85
78_W	117_S	0.838	0.84
73_K	113_R	0.834	0.84
15_A	56_L	0.833	0.84
105_L	111_C	0.831	0.84
136_F	146_K	0.809	0.82
28_Y	119_F	0.806	0.82
19_L	32_T	0.800	0.82
82_F	97_M	0.797	0.81
63_G	80_D	0.791	0.81
103_Q	107_E	0.788	0.81
27_S	121_N	0.786	0.80
128_L	131_R	0.779	0.80
13_R	42_C	0.768	0.79
45_Y	67_E	0.765	0.79
116_L	122_N	0.752	0.77
136_F	140_L	0.744	0.77
78_W	116_L	0.729	0.75
113_R	138_G	0.728	0.75
3_I	93_L	0.720	0.74
140_L	143_N	0.716	0.74
139_E	146_K	0.715	0.74
62_Y	80_D	0.714	0.74
8_V	12_N	0.714	0.74
119_F	148_M	0.705	0.73
52_Y	91_K	0.699	0.72
27_S	54_G	0.689	0.71
52_Y	57_V	0.689	0.71
62_Y	101_L	0.683	0.70
11_D	15_A	0.683	0.70
13_R	34_V	0.682	0.70
32_T	59_F	0.677	0.70
8_V	56_L	0.677	0.70
15_A	18_D	0.677	0.70
6_K	9_T	0.676	0.69
8_V	94_G	0.672	0.69
4_N	100_A	0.666	0.68
79_L	82_F	0.665	0.68
24_N	91_K	0.662	0.68
25_Q	124_H	0.651	0.67
20_H	33_K	0.649	0.66
58_G	89_Q	0.645	0.66
48_V	78_W	0.644	0.66
3_I	50_L	0.641	0.65
123_I	127_R	0.637	0.65
24_N	27_S	0.637	0.65
13_R	37_E	0.631	0.64
110_K	132_F	0.631	0.64
29_I	119_F	0.625	0.63
73_K	76_R	0.624	0.63
4_N	103_Q	0.622	0.63
29_I	47_P	0.622	0.63
15_A	52_Y	0.614	0.62
63_G	141_D	0.614	0.62
33_K	37_E	0.601	0.60
52_Y	96_K	0.599	0.60
5_I	100_A	0.597	0.60
118_I	146_K	0.596	0.60
8_V	39_A	0.590	0.59
30_E	61_M	0.589	0.59
37_E	40_K	0.585	0.58
53_E	123_I	0.577	0.57
85_D	134_F	0.575	0.57
45_Y	61_M	0.574	0.57
67_E	76_R	0.574	0.57
46_K	108_L	0.571	0.57
8_V	16_I	0.568	0.56
17_L	83_F	0.565	0.56
47_P	61_M	0.561	0.55
48_V	60_A	0.557	0.55
29_I	81_R	0.552	0.54
20_H	26_L	0.550	0.54
29_I	32_T	0.549	0.54
46_K	64_L	0.549	0.54
114_I	126_I	0.548	0.54
84_I	89_Q	0.548	0.54
23_Q	100_A	0.547	0.53
36_L	83_F	0.547	0.53
29_I	61_M	0.546	0.53
143_N	146_K	0.545	0.53
137_N	147_V	0.545	0.53
19_L	29_I	0.544	0.53
10_D	13_R	0.540	0.52
19_L	61_M	0.538	0.52
36_L	94_G	0.538	0.52
80_D	117_S	0.537	0.52
5_I	60_A	0.537	0.52
107_E	135_Q	0.537	0.52
29_I	35_C	0.536	0.52
46_K	62_Y	0.530	0.51
3_I	100_A	0.529	0.51
127_R	135_Q	0.527	0.51
46_K	125_A	0.527	0.51
103_Q	135_Q	0.526	0.51
126_I	146_K	0.526	0.51
95_K	101_L	0.524	0.50
15_A	99_K	0.524	0.50
61_M	129_Y	0.523	0.50
52_Y	88_Y	0.523	0.50
32_T	36_L	0.520	0.50
140_L	146_K	0.519	0.50
77_V	114_I	0.519	0.50
118_I	125_A	0.518	0.50
30_E	117_S	0.517	0.49
110_K	124_H	0.516	0.49
65_F	80_D	0.512	0.49
56_L	79_L	0.511	0.49
39_A	45_Y	0.510	0.49
13_R	114_I	0.503	0.48
49_G	83_F	0.502	0.47
29_I	116_L	0.500	0.47
94_G	124_H	0.500	0.47

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2fl4A	2	0.9539	99.9	0.522	Contact Map
1tiqA	1	0.9868	99.8	0.564	Contact Map
3fixA	2	0.9276	99.8	0.565	Contact Map
2ob0A	1	0.9474	99.8	0.568	Contact Map
3d8pA	1	0.9408	99.8	0.569	Contact Map
2r7hA	2	0.9539	99.8	0.572	Contact Map
1ufhA	3	0.9145	99.8	0.572	Contact Map
4qc6A	1	1	99.8	0.573	Contact Map
3d3sA	2	0.9474	99.8	0.573	Contact Map
2oh1A	1	0.9671	99.8	0.574	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.007 seconds.