PSS - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

PSS - CDP-diacylglycerol--serine O-phosphatidyltransferase

UniProt:	P39823	Sequences: MNYIPCMITIGNFICGLLAIHSLLYHNIHSAVLFIFTGMFLDFFDGMAARKLNAVSDMGRELDSFADLVTFGVAPSMLAYSVALYTLPFIGILCALTYSICGMLRLSKFNIEQSKLPTFIGMPIPFAGMCLVILSFTYNPILLAIGTCGLSYLMVSKIKFPHFKKHAAENLESGRWN	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	177 (164)
Sequences:	2481 (1511)
Seq/√Len:	118.0

BACSU - PSS
HALSA - Q9HRA7

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
102_G	124_I	7.242	1.00
38_G	70_T	4.849	1.00
8_I	48_A	3.792	1.00
10_I	62_L	3.525	1.00
19_A	74_A	3.304	1.00
102_G	154_M	3.006	1.00
149_G	153_L	2.655	1.00
68_L	103_M	2.525	1.00
57_D	61_E	2.456	1.00
97_T	151_S	2.346	1.00
12_N	70_T	2.258	1.00
69_V	73_V	2.237	1.00
40_F	44_F	2.087	1.00
15_C	34_F	2.067	1.00
14_I	96_L	2.040	1.00
10_I	100_I	1.992	1.00
98_Y	127_A	1.989	1.00
17_L	99_S	1.932	1.00
27_N	30_S	1.931	1.00
13_F	103_M	1.911	1.00
76_S	99_S	1.907	1.00
72_G	102_G	1.880	1.00
122_M	126_F	1.861	1.00
15_C	41_L	1.860	1.00
24_L	77_M	1.840	1.00
12_N	41_L	1.837	1.00
101_C	155_V	1.832	1.00
127_A	150_L	1.816	1.00
24_L	81_S	1.787	1.00
23_L	78_L	1.745	1.00
19_A	23_L	1.740	1.00
13_F	69_V	1.728	1.00
72_G	124_I	1.699	1.00
12_N	38_G	1.692	1.00
17_L	96_L	1.690	1.00
20_I	74_A	1.653	1.00
13_F	66_A	1.634	1.00
61_E	111_I	1.579	1.00
58_M	104_L	1.543	1.00
127_A	154_M	1.512	1.00
61_E	110_N	1.465	1.00
64_S	110_N	1.441	1.00
11_G	41_L	1.432	1.00
28_I	81_S	1.424	1.00
84_L	91_G	1.416	1.00
65_F	107_S	1.409	1.00
120_I	157_K	1.388	1.00
122_M	160_F	1.369	1.00
18_L	22_S	1.363	1.00
57_D	60_R	1.349	1.00
19_A	78_L	1.323	1.00
33_L	37_T	1.289	1.00
114_S	120_I	1.287	1.00
47_M	163_F	1.283	1.00
141_I	145_I	1.281	1.00
17_L	21_H	1.238	0.99
148_C	152_Y	1.236	0.99
39_M	129_M	1.232	0.99
101_C	151_S	1.219	0.99
79_A	147_T	1.213	0.99
131_L	147_T	1.212	0.99
94_C	148_C	1.210	0.99
4_I	52_L	1.196	0.99
108_K	156_S	1.180	0.99
83_A	86_T	1.168	0.99
12_N	16_G	1.155	0.99
8_I	11_G	1.150	0.99
118_T	159_K	1.122	0.99
20_I	73_V	1.073	0.98
68_L	124_I	1.069	0.98
23_L	81_S	1.053	0.98
41_L	70_T	1.044	0.98
94_C	144_A	1.033	0.98
76_S	95_A	1.032	0.98
87_L	144_A	1.000	0.97
125_P	128_G	0.967	0.97
5_P	54_A	0.940	0.96
7_M	11_G	0.929	0.96
98_Y	102_G	0.928	0.96
4_I	48_A	0.927	0.96
74_A	78_L	0.925	0.96
32_V	82_V	0.907	0.95
18_L	92_I	0.906	0.95
130_C	150_L	0.903	0.95
35_I	132_V	0.901	0.95
65_F	110_N	0.901	0.95
4_I	54_A	0.892	0.95
10_I	104_L	0.890	0.95
11_G	15_C	0.889	0.95
43_F	160_F	0.876	0.94
8_I	47_M	0.876	0.94
20_I	23_L	0.875	0.94
109_F	118_T	0.874	0.94
79_A	143_L	0.872	0.94
161_P	165_K	0.857	0.93
15_C	38_G	0.854	0.93
29_H	33_L	0.849	0.93
21_H	96_L	0.832	0.92
82_V	135_S	0.828	0.92
20_I	77_M	0.824	0.92
13_F	70_T	0.816	0.92
116_L	120_I	0.802	0.91
17_L	95_A	0.801	0.91
25_Y	29_H	0.795	0.91
114_S	157_K	0.794	0.91
73_V	99_S	0.792	0.90
66_A	70_T	0.791	0.90
41_L	125_P	0.790	0.90
97_T	148_C	0.778	0.90
45_D	67_D	0.772	0.89
15_C	37_T	0.755	0.88
13_F	68_L	0.755	0.88
47_M	51_K	0.749	0.88
143_L	147_T	0.746	0.88
81_S	123_P	0.744	0.87
71_F	125_P	0.739	0.87
85_Y	138_Y	0.738	0.87
16_G	74_A	0.734	0.87
22_S	30_S	0.732	0.87
80_Y	84_L	0.731	0.87
29_H	32_V	0.721	0.86
48_A	116_L	0.718	0.86
9_T	107_S	0.717	0.85
19_A	34_F	0.704	0.84
18_L	21_H	0.702	0.84
97_T	139_N	0.695	0.84
3_Y	10_I	0.694	0.84
77_M	96_L	0.693	0.83
134_L	143_L	0.693	0.83
37_T	41_L	0.688	0.83
130_C	160_F	0.687	0.83
58_M	111_I	0.687	0.83
151_S	155_V	0.686	0.83
61_E	65_F	0.684	0.83
11_G	70_T	0.682	0.83
6_C	62_L	0.672	0.82
86_T	141_I	0.671	0.81
59_G	67_D	0.667	0.81
16_G	126_F	0.661	0.81
137_T	140_P	0.654	0.80
33_L	136_F	0.651	0.80
45_D	59_G	0.650	0.79
25_Y	145_I	0.648	0.79
64_S	71_F	0.648	0.79
114_S	117_P	0.644	0.79
50_R	56_S	0.642	0.79
147_T	151_S	0.641	0.78
9_T	64_S	0.640	0.78
86_T	152_Y	0.637	0.78
116_L	165_K	0.637	0.78
32_V	136_F	0.633	0.78
18_L	146_G	0.632	0.77
28_I	78_L	0.627	0.77
23_L	31_A	0.625	0.77
7_M	10_I	0.625	0.77
8_I	41_L	0.624	0.77
58_M	62_L	0.623	0.76
35_I	78_L	0.620	0.76
65_F	158_I	0.619	0.76
104_L	111_I	0.619	0.76
25_Y	141_I	0.619	0.76
5_P	50_R	0.615	0.76
125_P	131_L	0.615	0.76
14_I	100_I	0.613	0.75
6_C	103_M	0.613	0.75
98_Y	131_L	0.612	0.75
42_D	45_D	0.611	0.75
152_Y	158_I	0.611	0.75
85_Y	142_L	0.610	0.75
22_S	27_N	0.606	0.75
91_G	94_C	0.602	0.74
34_F	37_T	0.602	0.74
6_C	10_I	0.599	0.74
68_L	157_K	0.599	0.74
12_N	66_A	0.599	0.74
120_I	134_L	0.599	0.74
56_S	107_S	0.598	0.74
131_L	150_L	0.593	0.73
28_I	82_V	0.592	0.73
80_Y	130_C	0.587	0.72
23_L	77_M	0.585	0.72
31_A	78_L	0.585	0.72
90_I	148_C	0.582	0.72
60_R	151_S	0.582	0.72
18_L	34_F	0.580	0.71
87_L	140_P	0.577	0.71
148_C	151_S	0.576	0.71
142_L	145_I	0.575	0.71
43_F	161_P	0.574	0.71
89_F	145_I	0.571	0.70
10_I	58_M	0.569	0.70
98_Y	151_S	0.567	0.70
57_D	137_T	0.566	0.69
22_S	141_I	0.565	0.69
61_E	64_S	0.565	0.69
57_D	115_K	0.564	0.69
8_I	34_F	0.564	0.69
106_L	121_G	0.562	0.69
14_I	21_H	0.560	0.69
102_G	127_A	0.559	0.68
69_V	75_P	0.557	0.68
106_L	109_F	0.550	0.67
63_D	67_D	0.549	0.67
78_L	135_S	0.548	0.67
61_E	107_S	0.547	0.67
141_I	144_A	0.542	0.66
100_I	104_L	0.539	0.66
108_K	124_I	0.539	0.66
65_F	103_M	0.539	0.66
14_I	18_L	0.537	0.65
130_C	146_G	0.537	0.65
35_I	74_A	0.536	0.65
86_T	147_T	0.536	0.65
39_M	60_R	0.536	0.65
45_D	63_D	0.532	0.65
14_I	17_L	0.530	0.64
23_L	43_F	0.530	0.64
89_F	138_Y	0.528	0.64
112_E	120_I	0.528	0.64
64_S	107_S	0.527	0.64
79_A	82_V	0.525	0.64
76_S	98_Y	0.524	0.64
22_S	34_F	0.523	0.63
101_C	104_L	0.522	0.63
16_G	70_T	0.521	0.63
5_P	52_L	0.521	0.63
12_N	60_R	0.519	0.63
42_D	67_D	0.518	0.63
93_L	148_C	0.517	0.63
79_A	131_L	0.517	0.63
133_I	160_F	0.517	0.63
52_L	62_L	0.517	0.63
11_G	39_M	0.515	0.62
19_A	31_A	0.515	0.62
15_C	60_R	0.514	0.62
21_H	77_M	0.512	0.62
21_H	28_I	0.512	0.62
139_N	143_L	0.512	0.62
6_C	122_M	0.508	0.61
77_M	81_S	0.505	0.61
149_G	152_Y	0.504	0.61
145_I	148_C	0.502	0.60
31_A	132_V	0.502	0.60
6_C	56_S	0.501	0.60
39_M	114_S	0.501	0.60
69_V	103_M	0.500	0.60

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4mndA	2	0.9096	99.8	0.638	Contact Map
4o6mA	2	0.9322	99.7	0.658	Contact Map
3tx3A	2	0.8249	17.3	0.946	Contact Map
3wu2Z	1	0.2316	9.6	0.952	Contact Map
2kncB	1	0.322	8.7	0.953	Contact Map
2za4B	1	0.4859	3	0.962	Contact Map
2cx6A	1	0.4689	2.5	0.964	Contact Map
4w251	1	0.2938	2.1	0.965	Contact Map
1rh5A	1	0.2938	1.7	0.967	Contact Map
2y69J	1	0.0395	1.6	0.967	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.007 seconds.