FLGM - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

FLGM - Negative regulator of flagellin synthesis

UniProt:	P39809	Sequences: MKINQFGTQSVNPYQKNYDKQAVQKTVAQPQDKIEISSQAKEMQHASDAVTGSRQEKIAQLKAQIENGSYKVDANHIAKNMINFYKKQ	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	88 (85)
Sequences:	179 (155)
Seq/√Len:	16.8

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
76_H	79_K	4.250	1.00
13_P	20_K	2.810	0.98
57_K	60_Q	2.739	0.97
42_E	61_L	2.333	0.93
82_I	86_K	2.235	0.92
56_E	60_Q	2.125	0.89
8_T	65_I	1.989	0.86
80_N	85_Y	1.731	0.77
71_K	77_I	1.622	0.72
24_Q	43_M	1.533	0.68
26_T	39_Q	1.526	0.67
44_Q	79_K	1.519	0.67
34_I	69_S	1.477	0.65
66_E	71_K	1.465	0.64
57_K	61_L	1.463	0.64
45_H	64_Q	1.440	0.63
73_D	76_H	1.406	0.61
74_A	77_I	1.353	0.58
45_H	81_M	1.334	0.57
11_V	56_E	1.310	0.55
72_V	81_M	1.310	0.55
41_K	56_E	1.292	0.54
41_K	45_H	1.292	0.54
56_E	79_K	1.279	0.53
10_S	67_N	1.270	0.53
49_A	65_I	1.241	0.51
15_Q	29_Q	1.224	0.50
43_M	69_S	1.218	0.50
9_Q	83_N	1.217	0.50
28_A	43_M	1.214	0.49
72_V	83_N	1.201	0.49
35_E	38_S	1.199	0.49
81_M	86_K	1.166	0.47
17_N	51_T	1.153	0.46
31_Q	77_I	1.135	0.45
38_S	61_L	1.132	0.45
15_Q	46_A	1.131	0.44
66_E	73_D	1.121	0.44
57_K	69_S	1.099	0.43
7_G	11_V	1.094	0.42
35_E	85_Y	1.090	0.42
67_N	71_K	1.081	0.42
13_P	54_R	1.080	0.42
72_V	77_I	1.062	0.40
9_Q	80_N	1.036	0.39
81_M	85_Y	1.026	0.38
38_S	41_K	1.021	0.38
61_L	64_Q	1.010	0.38
3_I	28_A	1.003	0.37
15_Q	39_Q	0.978	0.36
74_A	79_K	0.976	0.36
44_Q	75_N	0.968	0.35
43_M	72_V	0.954	0.34
4_N	84_F	0.952	0.34
3_I	33_K	0.942	0.34
17_N	34_I	0.940	0.34
64_Q	75_N	0.933	0.33
6_F	47_S	0.898	0.32
59_A	63_A	0.897	0.31
49_A	52_G	0.897	0.31
9_Q	39_Q	0.896	0.31
18_Y	41_K	0.871	0.30
8_T	44_Q	0.870	0.30
48_D	51_T	0.867	0.30
25_K	84_F	0.867	0.30
44_Q	83_N	0.856	0.29
11_V	85_Y	0.835	0.28
2_K	61_L	0.822	0.28
10_S	48_D	0.822	0.28
19_D	53_S	0.821	0.28
67_N	76_H	0.813	0.27
7_G	82_I	0.810	0.27
15_Q	73_D	0.806	0.27
4_N	19_D	0.802	0.27
23_V	62_K	0.802	0.27
43_M	51_T	0.787	0.26
46_A	51_T	0.777	0.26
3_I	70_Y	0.772	0.25
43_M	77_I	0.765	0.25
31_Q	69_S	0.762	0.25
11_V	57_K	0.754	0.25
2_K	84_F	0.752	0.25
57_K	65_I	0.745	0.24
58_I	73_D	0.740	0.24
8_T	15_Q	0.735	0.24
21_Q	80_N	0.724	0.23
20_K	23_V	0.724	0.23
8_T	39_Q	0.724	0.23
22_A	39_Q	0.719	0.23
20_K	80_N	0.712	0.23
60_Q	63_A	0.707	0.23
36_I	41_K	0.692	0.22
24_Q	77_I	0.691	0.22
2_K	7_G	0.689	0.22
67_N	72_V	0.688	0.22
5_Q	8_T	0.682	0.22
2_K	12_N	0.681	0.22
58_I	75_N	0.681	0.22
28_A	53_S	0.681	0.22
75_N	85_Y	0.680	0.22
46_A	49_A	0.678	0.21
13_P	48_D	0.677	0.21
12_N	62_K	0.664	0.21
26_T	65_I	0.661	0.21
69_S	85_Y	0.659	0.21
38_S	77_I	0.634	0.20
25_K	53_S	0.613	0.19
72_V	80_N	0.602	0.19
29_Q	42_E	0.590	0.18
24_Q	53_S	0.584	0.18
61_L	66_E	0.574	0.18
21_Q	47_S	0.567	0.17
22_A	33_K	0.565	0.17
71_K	74_A	0.562	0.17
56_E	77_I	0.554	0.17
60_Q	64_Q	0.551	0.17
10_S	46_A	0.547	0.17
6_F	9_Q	0.545	0.17
39_Q	44_Q	0.542	0.17
8_T	76_H	0.528	0.16
51_T	86_K	0.519	0.16
28_A	75_N	0.517	0.16
34_I	80_N	0.517	0.16
2_K	65_I	0.516	0.16
28_A	63_A	0.508	0.15
16_K	79_K	0.507	0.15
27_V	58_I	0.505	0.15
25_K	60_Q	0.500	0.15

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1rp3B	1	0.8977	99.7	0.447	Contact Map
2r1fA	4	0.2841	7.9	0.924	Contact Map
4iilA	1	0.7955	6.8	0.927	Contact Map
4iiwA	4	0.6705	6.3	0.927	Contact Map
1b0zA	4	0.4318	6.3	0.927	Contact Map
2flqA	2	0.6705	5.8	0.929	Contact Map
3h35A	3	0.0227	5.3	0.93	Contact Map
3lpzA	1	0.4091	4.7	0.932	Contact Map
4d0kA	1	0	4.4	0.933	Contact Map
2p61A	1	0.5455	4.3	0.933	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0052 seconds.