YVYG - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YVYG - Uncharacterized protein YvyG

UniProt:	P39808	Sequences: MSAKAIIEQLKRLCVLHEHLLTLSEEKTEALKAGKTKELSNILTKEQKYIQAITQTEDDRIKTTSAFLGYSENNTISACIAKTSGSEKEELEQLYESLSQVLGRLKKVNEMNRQLTRDALQFISISYDMLVPKENNFNYSKSIKAELPKSSKMKLFDSKA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	160 (155)
Sequences:	393 (334)
Seq/√Len:	26.8

BACSU - YVYG

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
19_H	49_Y	4.305	1.00
11_K	90_E	3.708	1.00
14_C	101_V	3.522	1.00
35_K	38_E	3.180	1.00
25_E	104_R	3.039	1.00
28_T	32_K	2.958	1.00
13_L	17_H	2.800	1.00
21_L	108_V	2.781	1.00
14_C	97_S	2.497	0.99
26_E	45_K	2.456	0.99
14_C	18_E	2.404	0.99
27_K	46_E	2.399	0.99
16_L	52_A	2.237	0.98
116_T	123_I	2.060	0.97
24_S	105_L	1.978	0.96
24_S	109_N	1.973	0.96
19_H	52_A	1.919	0.95
32_K	132_P	1.908	0.95
6_I	67_F	1.866	0.94
125_I	128_D	1.685	0.90
99_S	102_L	1.581	0.87
81_A	85_G	1.516	0.84
18_E	97_S	1.510	0.84
9_Q	56_T	1.509	0.84
26_E	38_E	1.501	0.84
25_E	108_V	1.483	0.83
21_L	101_V	1.481	0.83
122_F	126_S	1.444	0.81
128_D	156_F	1.431	0.81
7_I	94_L	1.407	0.80
132_P	158_S	1.402	0.79
10_L	112_N	1.381	0.78
31_L	116_T	1.353	0.77
131_V	155_L	1.351	0.77
38_E	41_N	1.343	0.76
77_S	110_E	1.309	0.74
53_I	138_N	1.294	0.73
7_I	159_K	1.286	0.73
75_T	118_D	1.283	0.73
50_I	130_L	1.280	0.73
21_L	42_I	1.278	0.73
28_T	108_V	1.218	0.69
54_T	78_A	1.214	0.69
65_S	86_S	1.211	0.68
17_H	158_S	1.205	0.68
72_E	102_L	1.202	0.68
14_C	94_L	1.196	0.67
30_A	39_L	1.189	0.67
116_T	120_L	1.179	0.66
101_V	143_I	1.152	0.64
111_M	114_Q	1.152	0.64
28_T	121_Q	1.147	0.64
55_Q	59_D	1.147	0.64
77_S	118_D	1.143	0.64
13_L	51_Q	1.142	0.64
16_L	79_C	1.140	0.64
121_Q	125_I	1.139	0.63
95_Y	99_S	1.134	0.63
28_T	47_Q	1.112	0.62
11_K	18_E	1.111	0.61
3_A	6_I	1.105	0.61
30_A	42_I	1.103	0.61
86_S	89_E	1.092	0.60
88_K	91_L	1.089	0.60
83_T	136_N	1.081	0.59
104_R	119_A	1.078	0.59
32_K	158_S	1.078	0.59
18_E	104_R	1.073	0.59
31_L	110_E	1.070	0.59
8_E	36_T	1.066	0.58
73_N	90_E	1.057	0.58
32_K	125_I	1.052	0.57
10_L	76_I	1.043	0.57
23_L	120_L	1.039	0.56
54_T	101_V	1.028	0.55
3_A	79_C	1.027	0.55
21_L	24_S	1.026	0.55
37_K	40_S	1.018	0.55
43_L	71_S	1.018	0.55
20_L	154_K	0.994	0.53
89_E	93_Q	0.983	0.52
65_S	123_I	0.978	0.52
24_S	108_V	0.972	0.51
34_G	41_N	0.968	0.51
117_R	120_L	0.967	0.51
105_L	119_A	0.962	0.51
124_S	157_D	0.961	0.50
40_S	127_Y	0.960	0.50
41_N	45_K	0.953	0.50
50_I	138_N	0.952	0.50
40_S	44_T	0.948	0.49
64_T	68_L	0.945	0.49
29_E	33_A	0.944	0.49
32_K	108_V	0.942	0.49
47_Q	109_N	0.941	0.49
97_S	104_R	0.921	0.47
121_Q	132_P	0.919	0.47
130_L	145_A	0.893	0.45
57_E	64_T	0.889	0.45
30_A	38_E	0.886	0.45
32_K	121_Q	0.882	0.45
16_L	49_Y	0.882	0.45
75_T	80_I	0.879	0.44
47_Q	68_L	0.873	0.44
8_E	12_R	0.871	0.44
16_L	116_T	0.870	0.44
65_S	152_K	0.868	0.43
57_E	60_R	0.867	0.43
25_E	89_E	0.850	0.42
21_L	157_D	0.849	0.42
18_E	93_Q	0.848	0.42
9_Q	63_T	0.840	0.41
127_Y	132_P	0.838	0.41
55_Q	132_P	0.838	0.41
17_H	68_L	0.838	0.41
110_E	149_K	0.834	0.41
49_Y	53_I	0.829	0.41
111_M	155_L	0.829	0.41
53_I	123_I	0.821	0.40
44_T	138_N	0.818	0.40
119_A	132_P	0.816	0.40
67_F	152_K	0.816	0.40
137_F	157_D	0.813	0.39
4_K	87_E	0.803	0.39
18_E	22_T	0.801	0.39
80_I	88_K	0.801	0.39
76_I	102_L	0.798	0.38
7_I	39_L	0.796	0.38
41_N	48_K	0.794	0.38
14_C	45_K	0.777	0.37
96_E	159_K	0.775	0.37
47_Q	136_N	0.775	0.37
86_S	127_Y	0.770	0.36
53_I	91_L	0.769	0.36
78_A	81_A	0.766	0.36
57_E	78_A	0.763	0.36
68_L	72_E	0.759	0.36
37_K	53_I	0.753	0.35
72_E	78_A	0.749	0.35
56_T	60_R	0.739	0.34
49_Y	121_Q	0.739	0.34
116_T	119_A	0.733	0.34
95_Y	102_L	0.732	0.34
3_A	107_K	0.732	0.34
11_K	94_L	0.723	0.33
94_L	110_E	0.719	0.33
79_C	85_G	0.719	0.33
120_L	135_N	0.711	0.32
76_I	95_Y	0.710	0.32
36_T	104_R	0.707	0.32
112_N	116_T	0.705	0.32
90_E	149_K	0.703	0.32
80_I	83_T	0.698	0.32
16_L	50_I	0.697	0.32
104_R	116_T	0.688	0.31
24_S	33_A	0.687	0.31
48_K	132_P	0.683	0.31
59_D	101_V	0.677	0.30
15_V	67_F	0.675	0.30
10_L	17_H	0.669	0.30
75_T	78_A	0.669	0.30
79_C	110_E	0.667	0.30
6_I	76_I	0.664	0.29
14_C	50_I	0.654	0.29
34_G	123_I	0.647	0.28
11_K	89_E	0.647	0.28
61_I	65_S	0.646	0.28
113_R	154_K	0.644	0.28
3_A	23_L	0.644	0.28
105_L	126_S	0.642	0.28
5_A	66_A	0.641	0.28
12_R	47_Q	0.641	0.28
45_K	76_I	0.639	0.28
91_L	156_F	0.638	0.28
133_K	159_K	0.636	0.28
57_E	61_I	0.632	0.27
64_T	157_D	0.630	0.27
33_A	94_L	0.628	0.27
13_L	31_L	0.622	0.27
62_K	97_S	0.621	0.27
36_T	123_I	0.620	0.27
10_L	47_Q	0.618	0.27
32_K	111_M	0.617	0.27
59_D	117_R	0.613	0.26
41_N	62_K	0.609	0.26
92_E	95_Y	0.607	0.26
35_K	41_N	0.605	0.26
53_I	127_Y	0.600	0.26
18_E	41_N	0.597	0.25
114_Q	135_N	0.594	0.25
110_E	113_R	0.594	0.25
23_L	136_N	0.588	0.25
87_E	90_E	0.588	0.25
17_H	53_I	0.588	0.25
92_E	96_E	0.586	0.25
66_A	144_K	0.586	0.25
13_L	121_Q	0.577	0.24
78_A	82_K	0.577	0.24
17_H	125_I	0.573	0.24
25_E	159_K	0.572	0.24
69_G	157_D	0.564	0.24
41_N	76_I	0.562	0.23
77_S	144_K	0.559	0.23
141_K	144_K	0.557	0.23
37_K	154_K	0.557	0.23
74_N	140_S	0.555	0.23
111_M	132_P	0.555	0.23
50_I	65_S	0.555	0.23
39_L	47_Q	0.552	0.23
10_L	77_S	0.550	0.23
119_A	155_L	0.550	0.23
17_H	132_P	0.546	0.23
12_R	19_H	0.545	0.23
23_L	128_D	0.544	0.23
130_L	133_K	0.543	0.22
18_E	29_E	0.543	0.22
4_K	156_F	0.540	0.22
9_Q	57_E	0.539	0.22
17_H	32_K	0.535	0.22
17_H	111_M	0.535	0.22
122_F	131_V	0.535	0.22
67_F	109_N	0.534	0.22
25_E	154_K	0.531	0.22
40_S	124_S	0.529	0.22
119_A	129_M	0.526	0.22
100_Q	104_R	0.522	0.21
50_I	105_L	0.514	0.21
154_K	158_S	0.513	0.21
104_R	107_K	0.512	0.21
32_K	35_K	0.512	0.21
112_N	139_Y	0.504	0.20
4_K	65_S	0.500	0.20

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3opcA	2	0.8	99.9	0.495	Contact Map
2fupA	1	0.7937	99.9	0.499	Contact Map
3a7mA	2	0.725	16.1	0.934	Contact Map
3ojaA	1	0.7312	11.5	0.938	Contact Map
3nkzA	4	0.575	9.6	0.94	Contact Map
4bwdA	2	0.3625	9.4	0.94	Contact Map
4jpsB	1	0.6687	7.9	0.943	Contact Map
2bnxA	2	0.1375	7.9	0.943	Contact Map
3vkgA	2	0.8375	6.8	0.944	Contact Map
4cg4A	2	0.9625	6	0.946	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0066 seconds.