CHEW - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

CHEW - Chemotaxis protein CheW

UniProt:	P39802	Sequences: MTAEIKTGEKMIVFMVNGKEYAISVTQVKSIEKWQKPTRVPGVEPYICGVINLRGVVTPVIDLRKRLNLPEYEITDETRIIIIAYRDIEVGWIVDEANDVITVHESEIESAPEGVQKDTDVSIEQIVKQENRLLNIIDANAVLDKESSQSAVPDQA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	156 (140)
Sequences:	5263 (3813)
Seq/√Len:	322.3

ECOLI - CHEW
BACSU - CHEW
HALSA - Q9HQW5 Q9HQY8

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
20_E	132_R	3.815	1.00
109_E	128_K	3.289	1.00
80_I	91_G	3.053	1.00
30_S	54_R	2.907	1.00
10_K	102_T	2.791	1.00
103_V	127_V	2.703	1.00
48_C	62_D	2.573	1.00
15_M	96_E	2.540	1.00
29_K	84_A	2.511	1.00
48_C	65_K	2.474	1.00
108_I	125_Q	2.389	1.00
48_C	93_I	2.368	1.00
104_H	107_E	2.349	1.00
27_Q	140_N	2.255	1.00
60_V	80_I	2.085	1.00
83_I	92_W	2.034	1.00
65_K	71_E	1.996	1.00
124_E	138_D	1.988	1.00
64_R	95_D	1.971	1.00
34_W	37_P	1.941	1.00
52_N	55_G	1.918	1.00
9_E	24_S	1.715	1.00
56_V	89_E	1.649	1.00
15_M	98_N	1.606	1.00
45_P	65_K	1.557	1.00
17_N	64_R	1.514	1.00
72_Y	75_T	1.509	1.00
20_E	98_N	1.508	1.00
52_N	57_V	1.485	1.00
74_I	78_T	1.471	1.00
121_V	141_A	1.450	1.00
33_K	79_R	1.445	1.00
75_T	78_T	1.426	1.00
7_T	105_E	1.419	1.00
34_W	80_I	1.405	1.00
29_K	89_E	1.395	1.00
11_M	136_I	1.370	1.00
24_S	124_E	1.344	1.00
13_V	20_E	1.329	1.00
60_V	91_G	1.327	1.00
48_C	74_I	1.324	1.00
123_I	135_N	1.309	1.00
129_Q	132_R	1.301	1.00
24_S	27_Q	1.301	1.00
14_F	81_I	1.293	1.00
51_I	80_I	1.283	1.00
108_I	136_I	1.275	1.00
9_E	105_E	1.264	1.00
58_T	82_I	1.241	1.00
23_I	83_I	1.223	1.00
29_K	56_V	1.221	1.00
15_M	18_G	1.189	1.00
62_D	65_K	1.170	1.00
107_E	129_Q	1.135	1.00
37_P	60_V	1.117	1.00
138_D	141_A	1.109	1.00
62_D	71_E	1.104	1.00
28_V	81_I	1.104	1.00
78_T	93_I	1.096	1.00
11_M	103_V	1.093	1.00
12_I	81_I	1.080	1.00
34_W	93_I	1.074	1.00
13_V	101_I	1.070	1.00
63_L	142_V	1.038	1.00
11_M	127_V	1.038	1.00
74_I	93_I	1.004	1.00
13_V	98_N	0.998	1.00
35_Q	80_I	0.993	1.00
12_I	79_R	0.992	1.00
22_A	136_I	0.984	1.00
127_V	136_I	0.981	1.00
23_I	139_A	0.964	1.00
51_I	60_V	0.959	1.00
17_N	69_L	0.955	1.00
8_G	102_T	0.954	1.00
86_R	140_N	0.951	1.00
83_I	139_A	0.944	1.00
22_A	127_V	0.941	1.00
62_D	66_R	0.939	1.00
53_L	82_I	0.937	1.00
22_A	134_L	0.927	1.00
13_V	99_D	0.923	1.00
12_I	31_I	0.919	1.00
13_V	134_L	0.917	1.00
7_T	104_H	0.911	1.00
64_R	69_L	0.904	1.00
15_M	20_E	0.878	1.00
14_F	23_I	0.875	1.00
63_L	92_W	0.868	1.00
27_Q	124_E	0.858	1.00
47_I	61_I	0.846	1.00
46_Y	66_R	0.837	1.00
34_W	79_R	0.835	1.00
37_P	51_I	0.834	1.00
84_A	89_E	0.827	1.00
81_I	94_V	0.826	1.00
32_E	80_I	0.824	1.00
111_A	123_I	0.824	1.00
64_R	70_P	0.819	1.00
16_V	63_L	0.816	1.00
47_I	59_P	0.815	1.00
80_I	93_I	0.809	1.00
8_G	104_H	0.806	1.00
8_G	105_E	0.804	1.00
32_E	35_Q	0.800	1.00
30_S	97_A	0.799	1.00
40_V	43_V	0.791	1.00
92_W	139_A	0.788	1.00
141_A	145_K	0.787	1.00
10_K	25_V	0.781	1.00
78_T	95_D	0.777	1.00
11_M	22_A	0.777	1.00
7_T	106_S	0.776	1.00
32_E	56_V	0.776	1.00
112_P	115_V	0.761	0.99
32_E	53_L	0.747	0.99
40_V	50_V	0.747	0.99
21_Y	67_L	0.740	0.99
117_K	120_D	0.738	0.99
42_G	45_P	0.728	0.99
128_K	133_L	0.727	0.99
40_V	114_G	0.720	0.99
12_I	126_I	0.718	0.99
72_Y	95_D	0.717	0.99
125_Q	136_I	0.715	0.99
38_T	57_V	0.714	0.99
94_V	97_A	0.709	0.99
141_A	144_D	0.707	0.99
27_Q	139_A	0.698	0.99
62_D	72_Y	0.691	0.99
38_T	41_P	0.691	0.99
69_L	72_Y	0.689	0.99
43_V	47_I	0.685	0.99
103_V	108_I	0.683	0.99
137_I	142_V	0.681	0.99
33_K	133_L	0.680	0.99
32_E	97_A	0.679	0.99
58_T	89_E	0.678	0.99
44_E	61_I	0.672	0.99
13_V	22_A	0.670	0.99
126_I	133_L	0.666	0.99
9_E	124_E	0.662	0.99
7_T	45_P	0.662	0.99
25_V	100_V	0.654	0.98
37_P	80_I	0.645	0.98
15_M	101_I	0.645	0.98
43_V	46_Y	0.638	0.98
135_N	138_D	0.636	0.98
118_D	121_V	0.636	0.98
82_I	89_E	0.631	0.98
58_T	91_G	0.627	0.98
23_I	92_W	0.627	0.98
48_C	71_E	0.627	0.98
21_Y	119_T	0.625	0.98
108_I	127_V	0.620	0.98
110_S	125_Q	0.616	0.98
16_V	90_V	0.612	0.98
113_E	120_D	0.608	0.98
128_K	131_N	0.599	0.97
66_R	146_E	0.599	0.97
35_Q	51_I	0.590	0.97
11_M	105_E	0.578	0.97
27_Q	85_Y	0.576	0.97
50_V	135_N	0.570	0.96
25_V	32_E	0.566	0.96
79_R	96_E	0.566	0.96
111_A	115_V	0.564	0.96
18_G	106_S	0.561	0.96
46_Y	65_K	0.559	0.96
32_E	58_T	0.559	0.96
18_G	72_Y	0.557	0.96
52_N	128_K	0.556	0.96
14_F	30_S	0.556	0.96
95_D	100_V	0.556	0.96
70_P	74_I	0.554	0.96
57_V	81_I	0.552	0.96
107_E	130_E	0.546	0.95
28_V	109_E	0.545	0.95
16_V	122_S	0.544	0.95
37_P	82_I	0.544	0.95
64_R	71_E	0.542	0.95
20_E	134_L	0.541	0.95
64_R	72_Y	0.539	0.95
59_P	78_T	0.539	0.95
57_V	135_N	0.536	0.95
26_T	29_K	0.534	0.95
34_W	78_T	0.532	0.95
87_D	106_S	0.532	0.95
12_I	33_K	0.530	0.95
39_R	43_V	0.530	0.95
25_V	61_I	0.525	0.94
25_V	31_I	0.523	0.94
18_G	45_P	0.523	0.94
53_L	87_D	0.522	0.94
70_P	130_E	0.522	0.94
66_R	145_K	0.517	0.94
54_R	91_G	0.516	0.94
129_Q	134_L	0.516	0.94
8_G	101_I	0.515	0.94
12_I	94_V	0.511	0.93
40_V	55_G	0.511	0.93
18_G	131_N	0.510	0.93
12_I	53_L	0.509	0.93
13_V	122_S	0.508	0.93
63_L	94_V	0.507	0.93
68_N	120_D	0.507	0.93
121_V	145_K	0.504	0.93
38_T	52_N	0.502	0.93
115_V	120_D	0.501	0.93
34_W	74_I	0.500	0.93

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2ho9A	1	1	100	0.186	Contact Map
2qdlA	1	0.9744	100	0.199	Contact Map
4jpbW	1	0.8974	100	0.229	Contact Map
1b3qA	2	0.8526	99.4	0.571	Contact Map
1knxA	5	0.9679	6.8	0.93	Contact Map
2xheA	1	0.3397	4.4	0.936	Contact Map
3ll7A	1	0.5897	4.3	0.936	Contact Map
3fanA	2	0.3718	4.1	0.937	Contact Map
1ko7A	3	0.8526	3.7	0.938	Contact Map
4otmA	2	0.5897	3.4	0.939	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0063 seconds.