ABH - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

ABH - Putative transition state regulator Abh

UniProt:	P39758	Sequences: MKSIGVVRKVDELGRIVMPIELRRALDIAIKDSIEFFVDGDKIILKKYKPHGVCLMTGEITSENKEYGNGKITLSPEGAQLLLEEIQAALKE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	92 (79)
Sequences:	825 (463)
Seq/√Len:	52.1

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
57_T	75_S	4.578	1.00
20_I	24_R	3.685	1.00
57_T	78_G	3.631	1.00
75_S	78_G	3.593	1.00
28_I	34_I	2.271	1.00
12_E	31_K	1.994	1.00
54_C	57_T	1.988	1.00
9_K	12_E	1.923	0.99
24_R	29_A	1.893	0.99
37_F	46_K	1.819	0.99
39_D	42_K	1.791	0.99
54_C	78_G	1.788	0.99
29_A	32_D	1.559	0.98
69_N	81_L	1.549	0.98
59_E	77_E	1.529	0.97
30_I	36_F	1.471	0.97
24_R	32_D	1.441	0.96
56_M	74_L	1.394	0.95
67_Y	70_G	1.392	0.95
55_L	74_L	1.383	0.95
64_N	76_P	1.363	0.95
42_K	46_K	1.320	0.94
3_S	50_P	1.318	0.94
80_Q	84_E	1.309	0.93
4_I	25_A	1.267	0.92
56_M	68_G	1.224	0.91
31_K	36_F	1.210	0.90
69_N	82_L	1.128	0.87
56_M	60_I	1.098	0.86
18_M	22_L	1.065	0.84
46_K	68_G	1.052	0.83
56_M	67_Y	1.046	0.83
7_V	43_I	1.026	0.81
27_D	82_L	1.023	0.81
12_E	20_I	1.018	0.81
54_C	75_S	0.983	0.79
56_M	71_K	0.968	0.78
29_A	42_K	0.962	0.77
79_A	83_L	0.941	0.76
6_V	21_E	0.940	0.75
43_I	64_N	0.933	0.75
55_L	68_G	0.904	0.73
65_K	75_S	0.896	0.72
6_V	25_A	0.870	0.70
53_V	57_T	0.869	0.70
10_V	17_V	0.856	0.68
78_G	83_L	0.853	0.68
74_L	78_G	0.853	0.68
4_I	38_V	0.850	0.68
72_I	77_E	0.849	0.68
36_F	45_L	0.845	0.67
56_M	78_G	0.818	0.65
25_A	30_I	0.815	0.65
3_S	43_I	0.815	0.65
40_G	80_Q	0.809	0.64
54_C	68_G	0.808	0.64
13_L	22_L	0.807	0.64
33_S	48_Y	0.792	0.62
64_N	70_G	0.791	0.62
7_V	24_R	0.790	0.62
2_K	40_G	0.789	0.62
72_I	75_S	0.786	0.62
41_D	59_E	0.754	0.58
9_K	29_A	0.752	0.58
18_M	31_K	0.750	0.58
69_N	79_A	0.743	0.57
42_K	61_T	0.741	0.57
18_M	55_L	0.731	0.56
59_E	69_N	0.720	0.55
10_V	20_I	0.717	0.55
3_S	12_E	0.714	0.54
37_F	84_E	0.714	0.54
27_D	32_D	0.713	0.54
7_V	12_E	0.703	0.53
16_I	64_N	0.688	0.52
30_I	44_I	0.683	0.51
28_I	47_K	0.670	0.50
17_V	23_R	0.662	0.49
54_C	58_G	0.655	0.48
77_E	80_Q	0.655	0.48
77_E	82_L	0.647	0.47
11_D	15_R	0.646	0.47
39_D	45_L	0.644	0.47
41_D	69_N	0.644	0.47
49_K	53_V	0.639	0.47
68_G	74_L	0.635	0.46
45_L	58_G	0.635	0.46
61_T	67_Y	0.631	0.46
65_K	70_G	0.628	0.45
20_I	40_G	0.627	0.45
61_T	76_P	0.625	0.45
20_I	33_S	0.605	0.43
78_G	82_L	0.593	0.42
49_K	66_E	0.589	0.41
65_K	72_I	0.586	0.41
3_S	36_F	0.578	0.40
39_D	44_I	0.575	0.40
34_I	50_P	0.574	0.40
57_T	83_L	0.573	0.40
29_A	49_K	0.569	0.39
14_G	23_R	0.566	0.39
58_G	75_S	0.565	0.39
20_I	82_L	0.564	0.39
5_G	21_E	0.562	0.39
30_I	84_E	0.557	0.38
48_Y	55_L	0.553	0.38
22_L	38_V	0.547	0.37
55_L	61_T	0.542	0.37
13_L	81_L	0.538	0.36
18_M	21_E	0.538	0.36
28_I	32_D	0.532	0.36
16_I	20_I	0.531	0.36
53_V	60_I	0.527	0.35
64_N	82_L	0.527	0.35
31_K	43_I	0.511	0.34
54_C	74_L	0.501	0.33
19_P	35_E	0.501	0.33
77_E	81_L	0.500	0.33

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2w1tA	2	0.9565	99.6	0.554	Contact Map
1yfbA	2	0.5543	99.3	0.622	Contact Map
2mrnA	2	0.5543	98.7	0.71	Contact Map
2l66A	2	0.5543	98.6	0.719	Contact Map
3o27A	2	0.5217	97.9	0.763	Contact Map
2glwA	1	0.5	97.5	0.784	Contact Map
1mvfD	1	0.4783	97.5	0.784	Contact Map
2mjgA	2	0.4783	97.3	0.793	Contact Map
1n0eA	5	0.7609	67.2	0.889	Contact Map
2ds5A	2	0.4674	60.6	0.894	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0043 seconds.