FLIT - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

FLIT - Flagellar protein FliT

UniProt:	P39740	Sequences: MNNIDQLYTETKSMLSHIQNTPESDELLKQIEDFVATRSELIQEISLPLSEEERKQMKLILTWDQLIVKEMERLKQSIATELQQMKRKRVMHTTYLNPYNNITIDGTYYDKRK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	113 (112)
Sequences:	131 (112)
Seq/√Len:	10.5

BACSU - FLIT

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
64_D	108_Y	3.851	0.99
75_K	79_A	3.810	0.99
39_S	43_Q	2.427	0.83
18_I	83_Q	2.217	0.77
25_D	109_Y	2.185	0.76
18_I	90_V	2.014	0.70
74_L	85_M	1.989	0.69
60_I	63_W	1.910	0.66
64_D	68_V	1.788	0.60
4_I	111_K	1.787	0.60
23_E	112_R	1.785	0.60
88_K	109_Y	1.784	0.60
29_K	65_Q	1.759	0.59
14_M	34_F	1.667	0.55
17_H	77_S	1.588	0.51
75_K	109_Y	1.585	0.51
50_S	53_E	1.571	0.50
18_I	33_D	1.565	0.50
30_Q	42_I	1.542	0.49
45_I	107_T	1.511	0.47
25_D	108_Y	1.509	0.47
33_D	51_E	1.475	0.46
25_D	92_H	1.454	0.45
28_L	63_W	1.414	0.43
11_T	36_A	1.402	0.42
14_M	89_R	1.402	0.42
22_P	108_Y	1.374	0.41
11_T	86_K	1.367	0.41
37_T	54_R	1.367	0.41
17_H	35_V	1.365	0.41
14_M	24_S	1.346	0.40
61_L	108_Y	1.321	0.39
53_E	60_I	1.319	0.39
13_S	52_E	1.302	0.38
25_D	85_M	1.261	0.36
2_N	63_W	1.258	0.36
12_K	59_L	1.258	0.36
64_D	94_T	1.247	0.35
4_I	59_L	1.233	0.35
74_L	104_I	1.223	0.34
78_I	81_E	1.217	0.34
67_I	102_I	1.211	0.34
8_Y	63_W	1.180	0.33
11_T	54_R	1.170	0.32
31_I	61_L	1.166	0.32
26_E	44_E	1.161	0.32
7_L	17_H	1.140	0.31
57_M	108_Y	1.139	0.31
49_L	57_M	1.113	0.30
35_V	112_R	1.104	0.29
5_D	86_K	1.102	0.29
24_S	108_Y	1.095	0.29
4_I	32_E	1.089	0.29
11_T	47_L	1.088	0.29
24_S	81_E	1.087	0.29
87_R	112_R	1.059	0.28
17_H	27_L	1.048	0.27
30_Q	34_F	1.046	0.27
100_N	103_T	1.044	0.27
48_P	53_E	1.016	0.26
38_R	110_D	1.016	0.26
38_R	95_Y	1.016	0.26
95_Y	110_D	1.016	0.26
9_T	82_L	1.014	0.26
7_L	10_E	1.008	0.26
2_N	111_K	1.006	0.26
81_E	94_T	0.995	0.25
75_K	78_I	0.993	0.25
57_M	63_W	0.988	0.25
46_S	61_L	0.982	0.25
22_P	27_L	0.974	0.25
40_E	69_K	0.968	0.24
51_E	55_K	0.964	0.24
92_H	108_Y	0.960	0.24
77_S	80_T	0.958	0.24
34_F	43_Q	0.947	0.24
71_M	81_E	0.942	0.24
24_S	28_L	0.932	0.23
45_I	48_P	0.929	0.23
42_I	64_D	0.893	0.22
100_N	104_I	0.893	0.22
15_L	82_L	0.890	0.22
71_M	78_I	0.885	0.22
52_E	99_Y	0.878	0.21
49_L	107_T	0.872	0.21
49_L	92_H	0.851	0.21
52_E	58_K	0.845	0.20
7_L	103_T	0.826	0.20
60_I	94_T	0.808	0.19
39_S	62_T	0.805	0.19
28_L	81_E	0.802	0.19
75_K	102_I	0.802	0.19
95_Y	106_G	0.801	0.19
38_R	106_G	0.801	0.19
106_G	110_D	0.801	0.19
78_I	109_Y	0.794	0.19
28_L	97_N	0.793	0.19
71_M	80_T	0.783	0.19
73_R	93_T	0.773	0.18
17_H	75_K	0.755	0.18
28_L	43_Q	0.753	0.18
48_P	98_P	0.751	0.18
35_V	71_M	0.750	0.18
89_R	93_T	0.737	0.17
42_I	102_I	0.736	0.17
21_T	96_L	0.734	0.17
37_T	60_I	0.729	0.17
67_I	111_K	0.722	0.17
8_Y	64_D	0.718	0.17
43_Q	51_E	0.714	0.17
46_S	107_T	0.712	0.17
19_Q	65_Q	0.711	0.17
53_E	59_L	0.707	0.17
9_T	12_K	0.705	0.16
7_L	36_A	0.704	0.16
22_P	74_L	0.704	0.16
35_V	60_I	0.703	0.16
67_I	74_L	0.702	0.16
14_M	36_A	0.698	0.16
5_D	56_Q	0.698	0.16
9_T	32_E	0.697	0.16
11_T	48_P	0.691	0.16
32_E	109_Y	0.687	0.16
29_K	73_R	0.686	0.16
13_S	34_F	0.678	0.16
3_N	41_L	0.677	0.16
86_K	108_Y	0.666	0.15
74_L	80_T	0.664	0.15
4_I	63_W	0.663	0.15
62_T	72_E	0.655	0.15
17_H	71_M	0.649	0.15
31_I	63_W	0.646	0.15
67_I	79_A	0.640	0.15
72_E	101_N	0.639	0.15
96_L	100_N	0.623	0.14
28_L	83_Q	0.621	0.14
12_K	54_R	0.617	0.14
60_I	66_L	0.613	0.14
32_E	55_K	0.608	0.14
35_V	104_I	0.600	0.14
28_L	51_E	0.598	0.14
23_E	74_L	0.592	0.14
7_L	42_I	0.587	0.14
51_E	54_R	0.581	0.14
79_A	108_Y	0.575	0.13
2_N	8_Y	0.574	0.13
49_L	100_N	0.572	0.13
51_E	107_T	0.568	0.13
50_S	65_Q	0.554	0.13
41_L	44_E	0.550	0.13
93_T	100_N	0.548	0.13
17_H	22_P	0.544	0.13
63_W	90_V	0.533	0.12
70_E	74_L	0.531	0.12
18_I	67_I	0.529	0.12
15_L	67_I	0.528	0.12
59_L	90_V	0.524	0.12
78_I	88_K	0.523	0.12
68_V	88_K	0.519	0.12
14_M	67_I	0.519	0.12
33_D	37_T	0.518	0.12
7_L	111_K	0.517	0.12
79_A	101_N	0.517	0.12
36_A	86_K	0.515	0.12
7_L	49_L	0.503	0.12
29_K	93_T	0.503	0.12
34_F	100_N	0.500	0.12
63_W	83_Q	0.500	0.12

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2fztA	2	0.6903	91.8	0.86	Contact Map
3h3mA	2	0.6814	80.2	0.883	Contact Map
3a7mA	2	0.9027	70.4	0.892	Contact Map
3nkzA	4	0.6903	53.4	0.903	Contact Map
4kf8A	1	0.6726	41.2	0.91	Contact Map
1vt0M	4	0.5398	35.2	0.913	Contact Map
5ajdB	1	0.1416	25.9	0.919	Contact Map
3gn4A	1	0.531	20.4	0.923	Contact Map
3nmdA	2	0.4779	17.8	0.925	Contact Map
4uqzB	1	0	10.9	0.932	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0059 seconds.