FLIS - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

FLIS - Flagellar protein FliS

UniProt:	P39739	Sequences: MAIQNPYTAYQQNSVNTATPGELTLMLYNGCLKFIRLAAQAIENDDMERKNENLIKAQNIIQELNFTLNRNIELSASMGAMYDYMYRRLVQANIKNDTGMLAEVEGYVTDFRDAWKQAIQSERKDRHGSGGIA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	133 (118)
Sequences:	1671 (1261)
Seq/√Len:	116.1

ECOLI - FLIS
BACSU - FLIS

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
39_A	102_A	3.272	1.00
85_M	104_V	3.114	1.00
65_N	79_G	2.988	1.00
31_C	108_V	2.972	1.00
88_R	100_M	2.872	1.00
35_I	101_L	2.867	1.00
88_R	103_E	2.838	1.00
50_K	96_N	2.491	1.00
46_D	49_R	2.372	1.00
43_E	98_T	2.241	1.00
29_N	112_R	2.196	1.00
83_D	87_R	2.187	1.00
73_E	77_S	2.141	1.00
51_N	55_I	2.093	1.00
112_R	116_K	2.031	1.00
69_N	72_I	1.904	1.00
85_M	107_Y	1.901	1.00
40_Q	44_N	1.839	1.00
32_L	105_E	1.774	1.00
84_Y	103_E	1.710	1.00
27_L	60_I	1.546	1.00
21_G	118_A	1.535	1.00
88_R	91_Q	1.523	1.00
42_I	50_K	1.517	1.00
70_R	75_S	1.479	1.00
54_L	101_L	1.425	1.00
85_M	108_V	1.422	1.00
25_L	116_K	1.410	1.00
54_L	89_L	1.395	1.00
70_R	79_G	1.383	1.00
42_I	98_T	1.383	1.00
61_I	85_M	1.343	1.00
21_G	119_I	1.314	1.00
30_G	34_F	1.304	1.00
97_D	100_M	1.304	1.00
49_R	52_E	1.274	0.99
39_A	105_E	1.259	0.99
8_T	11_Q	1.207	0.99
48_E	52_E	1.200	0.99
31_C	57_A	1.191	0.99
39_A	98_T	1.179	0.99
84_Y	88_R	1.178	0.99
34_F	56_K	1.148	0.99
35_I	105_E	1.144	0.99
28_Y	111_F	1.119	0.99
37_L	53_N	1.117	0.99
70_R	76_A	1.108	0.98
77_S	80_A	1.102	0.98
113_D	117_Q	1.099	0.98
34_F	53_N	1.098	0.98
26_M	30_G	1.086	0.98
72_I	75_S	1.068	0.98
24_T	67_T	1.066	0.98
103_E	107_Y	1.034	0.98
114_A	117_Q	1.011	0.97
31_C	61_I	0.992	0.97
99_G	103_E	0.987	0.97
88_R	104_V	0.983	0.97
47_M	51_N	0.976	0.97
95_K	100_M	0.973	0.97
111_F	114_A	0.969	0.96
81_M	85_M	0.965	0.96
62_Q	66_F	0.959	0.96
105_E	109_T	0.956	0.96
52_E	56_K	0.948	0.96
41_A	49_R	0.941	0.96
24_T	118_A	0.927	0.95
30_G	60_I	0.921	0.95
98_T	102_A	0.915	0.95
78_M	111_F	0.901	0.95
91_Q	100_M	0.895	0.95
36_R	105_E	0.881	0.94
51_N	93_N	0.874	0.94
22_E	29_N	0.866	0.94
19_T	119_I	0.863	0.93
56_K	59_N	0.858	0.93
41_A	46_D	0.856	0.93
87_R	91_Q	0.843	0.93
84_Y	107_Y	0.841	0.92
51_N	58_Q	0.825	0.92
81_M	107_Y	0.804	0.91
65_N	83_D	0.801	0.91
113_D	116_K	0.798	0.90
35_I	57_A	0.797	0.90
62_Q	86_Y	0.789	0.90
54_L	93_N	0.788	0.90
59_N	62_Q	0.783	0.90
110_D	113_D	0.782	0.89
33_K	37_L	0.780	0.89
84_Y	100_M	0.778	0.89
14_S	22_E	0.772	0.89
43_E	102_A	0.771	0.89
99_G	102_A	0.762	0.88
59_N	63_E	0.760	0.88
106_G	110_D	0.760	0.88
91_Q	95_K	0.758	0.88
51_N	96_N	0.758	0.88
30_G	56_K	0.752	0.88
25_L	112_R	0.744	0.87
49_R	53_N	0.742	0.87
90_V	94_I	0.742	0.87
42_I	96_N	0.739	0.87
39_A	43_E	0.726	0.86
70_R	74_L	0.718	0.85
53_N	56_K	0.714	0.85
32_L	36_R	0.714	0.85
65_N	86_Y	0.713	0.85
38_A	54_L	0.711	0.85
35_I	89_L	0.705	0.84
80_A	83_D	0.703	0.84
55_I	59_N	0.700	0.84
41_A	53_N	0.697	0.83
26_M	60_I	0.694	0.83
62_Q	65_N	0.691	0.83
13_N	17_T	0.682	0.82
118_A	122_E	0.682	0.82
24_T	115_W	0.679	0.82
86_Y	90_V	0.678	0.82
41_A	44_N	0.675	0.81
109_T	113_D	0.673	0.81
76_A	80_A	0.668	0.81
17_T	86_Y	0.651	0.79
47_M	96_N	0.649	0.79
5_N	8_T	0.648	0.79
117_Q	121_S	0.643	0.78
27_L	30_G	0.639	0.78
58_Q	86_Y	0.636	0.77
71_N	75_S	0.632	0.77
93_N	96_N	0.630	0.77
31_C	60_I	0.625	0.76
48_E	51_N	0.624	0.76
7_Y	11_Q	0.623	0.76
13_N	16_N	0.622	0.76
63_E	66_F	0.621	0.76
55_I	58_Q	0.621	0.76
92_A	101_L	0.620	0.76
37_L	49_R	0.619	0.75
36_R	109_T	0.614	0.75
52_E	55_I	0.613	0.75
40_Q	43_E	0.613	0.75
36_R	39_A	0.603	0.74
26_M	29_N	0.602	0.73
50_K	55_I	0.598	0.73
32_L	109_T	0.598	0.73
34_F	37_L	0.586	0.71
9_A	12_Q	0.576	0.70
42_I	101_L	0.573	0.70
74_L	77_S	0.572	0.70
74_L	81_M	0.570	0.69
6_P	9_A	0.568	0.69
47_M	50_K	0.567	0.69
18_A	26_M	0.561	0.68
66_F	69_N	0.560	0.68
54_L	92_A	0.556	0.67
28_Y	74_L	0.553	0.67
18_A	115_W	0.551	0.67
57_A	89_L	0.550	0.67
47_M	93_N	0.548	0.66
102_A	106_G	0.543	0.66
110_D	114_A	0.541	0.65
73_E	76_A	0.540	0.65
87_R	97_D	0.533	0.64
24_T	119_I	0.533	0.64
20_P	24_T	0.531	0.64
12_Q	16_N	0.529	0.64
14_S	37_L	0.526	0.63
20_P	115_W	0.524	0.63
25_L	119_I	0.522	0.63
18_A	23_L	0.516	0.62
114_A	121_S	0.514	0.61
23_L	63_E	0.510	0.61
50_K	58_Q	0.508	0.61
63_E	67_T	0.508	0.61
107_Y	110_D	0.507	0.60
22_E	25_L	0.507	0.60
61_I	89_L	0.504	0.60
24_T	29_N	0.500	0.59

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1vh6A	2	0.812	100	0.082	Contact Map
3iqcA	2	0.8797	100	0.143	Contact Map
4iwbA	1	0.9173	100	0.198	Contact Map
2rklA	2	0.3609	16.1	0.93	Contact Map
3sjrA	2	0.5489	15.9	0.93	Contact Map
2za4B	1	0.594	13.3	0.933	Contact Map
4p3fA	2	0.6316	9.2	0.937	Contact Map
2rgnB	1	0.5639	8.5	0.938	Contact Map
2nrjA	1	0.812	8	0.939	Contact Map
2hsbA	2	0.7218	7.8	0.939	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.006 seconds.