YVYC - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YVYC - Uncharacterized protein YvyC

UniProt:	P39737	Sequences: MNIERLTTLQPVWDRYDTQIHNQKDNDNEVPVHQVSYTNLAEMVGEMNKLLEPSQVHLKFELHDKLNEYYVKVIEDSTNEVIREIPPKRWLDFYAAMTEFLGLFVDEKK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	109 (93)
Sequences:	388 (348)
Seq/√Len:	36.1

BACSU - YVYC

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
65_K	99_E	4.096	1.00
62_L	69_Y	3.067	1.00
63_H	92_D	3.019	1.00
57_H	76_D	2.885	1.00
96_A	99_E	2.549	1.00
96_A	100_F	2.377	1.00
56_V	73_V	2.243	0.99
58_L	71_V	2.206	0.99
73_V	83_R	2.167	0.99
43_M	90_W	1.904	0.98
66_L	98_T	1.865	0.97
16_Y	40_L	1.841	0.97
63_H	95_A	1.669	0.95
89_R	105_V	1.630	0.94
53_P	94_Y	1.609	0.94
61_E	70_Y	1.585	0.94
66_L	70_Y	1.580	0.93
85_I	89_R	1.468	0.91
89_R	108_K	1.462	0.90
66_L	69_Y	1.456	0.90
72_K	90_W	1.455	0.90
26_N	33_H	1.444	0.90
60_F	68_E	1.437	0.90
49_K	52_E	1.388	0.88
91_L	95_A	1.326	0.86
68_E	94_Y	1.314	0.85
35_V	40_L	1.258	0.82
61_E	72_K	1.254	0.82
42_E	45_G	1.249	0.82
66_L	88_K	1.207	0.80
70_Y	97_M	1.206	0.80
69_Y	88_K	1.193	0.79
58_L	83_R	1.184	0.78
47_M	51_L	1.180	0.78
69_Y	94_Y	1.175	0.78
94_Y	98_T	1.174	0.78
18_T	21_H	1.158	0.77
17_D	25_D	1.148	0.76
28_N	38_T	1.143	0.76
48_N	60_F	1.109	0.74
82_I	87_P	1.099	0.73
92_D	95_A	1.046	0.69
66_L	97_M	1.037	0.68
21_H	24_K	1.034	0.68
75_E	80_E	1.012	0.66
27_D	30_V	1.008	0.66
24_K	28_N	1.005	0.66
93_F	104_F	0.990	0.65
66_L	94_Y	0.990	0.65
64_D	91_L	0.980	0.64
19_Q	26_N	0.948	0.61
96_A	107_E	0.947	0.61
87_P	90_W	0.947	0.61
91_L	106_D	0.932	0.60
41_A	60_F	0.927	0.60
93_F	98_T	0.922	0.59
74_I	81_V	0.919	0.59
22_N	104_F	0.897	0.57
16_Y	26_N	0.896	0.57
46_E	53_P	0.895	0.57
61_E	88_K	0.869	0.55
77_S	107_E	0.855	0.53
39_N	101_L	0.828	0.51
94_Y	97_M	0.819	0.50
69_Y	98_T	0.818	0.50
20_I	28_N	0.797	0.48
62_L	88_K	0.788	0.48
39_N	49_K	0.783	0.47
23_Q	40_L	0.781	0.47
25_D	36_S	0.779	0.47
16_Y	22_N	0.778	0.47
17_D	30_V	0.775	0.46
54_S	75_E	0.775	0.46
19_Q	30_V	0.773	0.46
90_W	93_F	0.762	0.45
52_E	77_S	0.756	0.45
18_T	28_N	0.743	0.44
69_Y	101_L	0.741	0.44
99_E	107_E	0.730	0.43
90_W	94_Y	0.722	0.42
98_T	101_L	0.721	0.42
65_K	103_L	0.720	0.42
54_S	83_R	0.720	0.42
79_N	107_E	0.718	0.42
59_K	72_K	0.712	0.41
47_M	59_K	0.709	0.41
80_E	97_M	0.706	0.41
46_E	50_L	0.704	0.40
93_F	99_E	0.702	0.40
91_L	98_T	0.693	0.39
19_Q	36_S	0.691	0.39
60_F	71_V	0.690	0.39
18_T	25_D	0.679	0.38
53_P	98_T	0.675	0.38
98_T	104_F	0.675	0.38
28_N	36_S	0.673	0.38
21_H	28_N	0.672	0.38
28_N	40_L	0.670	0.38
43_M	67_N	0.669	0.37
49_K	101_L	0.665	0.37
33_H	49_K	0.662	0.37
87_P	91_L	0.661	0.37
35_V	87_P	0.654	0.36
50_L	88_K	0.653	0.36
46_E	51_L	0.642	0.35
63_H	70_Y	0.640	0.35
58_L	73_V	0.638	0.35
37_Y	41_A	0.636	0.35
60_F	74_I	0.627	0.34
29_E	38_T	0.626	0.34
78_T	92_D	0.625	0.34
32_V	35_V	0.606	0.32
50_L	66_L	0.604	0.32
80_E	92_D	0.604	0.32
71_V	90_W	0.600	0.32
27_D	39_N	0.600	0.32
22_N	25_D	0.599	0.32
42_E	57_H	0.596	0.32
19_Q	23_Q	0.587	0.31
61_E	83_R	0.577	0.30
23_Q	30_V	0.572	0.30
21_H	32_V	0.572	0.30
17_D	27_D	0.571	0.30
19_Q	22_N	0.569	0.30
32_V	36_S	0.566	0.30
19_Q	29_E	0.564	0.29
57_H	74_I	0.562	0.29
17_D	32_V	0.559	0.29
81_V	100_F	0.553	0.29
52_E	74_I	0.547	0.28
72_K	106_D	0.541	0.28
44_V	48_N	0.541	0.28
70_Y	82_I	0.539	0.28
23_Q	35_V	0.534	0.27
78_T	85_I	0.530	0.27
51_L	89_R	0.529	0.27
58_L	65_K	0.525	0.27
36_S	100_F	0.524	0.27
16_Y	23_Q	0.519	0.26
68_E	83_R	0.500	0.25

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2hc5A	1	1	99.9	0.265	Contact Map
3nw0A	1	0.8899	38.3	0.904	Contact Map
2qupA	1	0.789	26	0.912	Contact Map
1zatA	1	0.4404	11.4	0.925	Contact Map
4jbuA	1	0.367	10.2	0.927	Contact Map
4exrA	2	0.7339	7.1	0.932	Contact Map
2p61A	1	0.7523	4.2	0.939	Contact Map
4tr6A	2	0.7248	3.9	0.94	Contact Map
4bh6I	1	0.422	3.8	0.94	Contact Map
3t0pA	2	0.7156	3.2	0.942	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0051 seconds.