BACA - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

BACA - Bacilysin biosynthesis protein BacA

UniProt:	P39638	Sequences: MIILDNSIQTKKRTDSLSKLITVNTLGPEGTSSEYAAKHFISNFTLLQGLNSKLSLHDTFESCIERTLQSPLEYTIVPHAYDGIKHFYMRPDLQLLQIFRCDTPMYGLAVRPDFEFRDDMLDTSVIVSHPSPINLIKYFTRKDVRFKLVNSTSQAARKVKEGLYDIALTNELARQKYGLTFVKTFKSIPMSWSLFGKGDVDDEN	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	204 (167)
Sequences:	129 (107)
Seq/√Len:	8.3

BACSU - BACA

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
60_F	78_P	3.203	0.91
76_I	194_L	3.045	0.89
129_H	190_M	2.854	0.86
127_V	164_Y	2.793	0.84
32_S	152_T	2.605	0.80
32_S	195_F	2.454	0.75
99_F	151_S	2.272	0.69
79_H	191_S	2.210	0.67
80_A	151_S	2.135	0.64
24_N	67_T	2.113	0.63
152_T	195_F	2.059	0.61
132_P	190_M	2.028	0.60
60_F	170_N	2.023	0.60
80_A	88_Y	2.021	0.60
132_P	170_N	1.987	0.58
104_P	195_F	1.955	0.57
32_S	106_Y	1.939	0.57
192_W	195_F	1.890	0.55
28_P	31_T	1.860	0.53
33_S	77_V	1.789	0.50
80_A	99_F	1.756	0.49
106_Y	152_T	1.699	0.47
24_N	57_H	1.683	0.46
31_T	103_T	1.672	0.45
103_T	156_A	1.658	0.45
23_V	83_G	1.650	0.45
78_P	89_M	1.643	0.44
132_P	173_A	1.632	0.44
159_V	195_F	1.580	0.42
156_A	173_A	1.554	0.41
89_M	188_I	1.538	0.40
28_P	56_L	1.536	0.40
87_F	104_P	1.534	0.40
89_M	106_Y	1.512	0.39
33_S	192_W	1.499	0.38
103_T	106_Y	1.462	0.37
60_F	192_W	1.449	0.36
103_T	165_D	1.447	0.36
24_N	72_L	1.444	0.36
136_I	170_N	1.432	0.36
56_L	165_D	1.416	0.35
146_F	182_V	1.412	0.35
130_P	190_M	1.391	0.34
151_S	169_T	1.385	0.34
89_M	190_M	1.382	0.34
78_P	192_W	1.378	0.34
77_V	192_W	1.364	0.33
59_T	131_S	1.341	0.32
29_E	45_T	1.336	0.32
54_L	66_R	1.311	0.31
88_Y	152_T	1.304	0.31
62_S	112_P	1.298	0.31
132_P	188_I	1.297	0.31
58_D	66_R	1.223	0.28
34_E	88_Y	1.218	0.28
71_P	163_L	1.198	0.27
55_S	111_R	1.197	0.27
39_H	43_N	1.189	0.27
80_A	89_M	1.182	0.27
63_C	78_P	1.180	0.27
78_P	159_V	1.167	0.26
22_T	73_E	1.163	0.26
32_S	192_W	1.161	0.26
31_T	56_L	1.158	0.26
159_V	192_W	1.156	0.26
40_F	192_W	1.155	0.26
34_E	56_L	1.153	0.26
78_P	170_N	1.145	0.26
107_G	152_T	1.141	0.26
89_M	152_T	1.137	0.25
32_S	188_I	1.134	0.25
32_S	132_P	1.122	0.25
80_A	104_P	1.112	0.25
132_P	153_S	1.107	0.24
106_Y	195_F	1.100	0.24
131_S	190_M	1.099	0.24
77_V	159_V	1.084	0.24
23_V	38_K	1.078	0.24
107_G	167_A	1.072	0.23
35_Y	101_C	1.067	0.23
173_A	179_L	1.061	0.23
23_V	53_K	1.057	0.23
39_H	101_C	1.050	0.23
129_H	132_P	1.045	0.23
167_A	181_F	1.040	0.22
23_V	116_F	1.037	0.22
60_F	80_A	1.023	0.22
32_S	159_V	1.020	0.22
153_S	156_A	1.013	0.22
33_S	195_F	1.012	0.22
103_T	109_A	1.003	0.21
22_T	53_K	1.000	0.21
33_S	194_L	0.999	0.21
24_N	73_E	0.998	0.21
32_S	88_Y	0.997	0.21
132_P	195_F	0.996	0.21
93_L	154_Q	0.996	0.21
33_S	191_S	0.993	0.21
23_V	29_E	0.973	0.21
23_V	95_L	0.959	0.20
79_H	106_Y	0.954	0.20
89_M	104_P	0.954	0.20
60_F	77_V	0.944	0.20
61_E	194_L	0.939	0.20
81_Y	156_A	0.938	0.20
170_N	195_F	0.935	0.20
128_S	164_Y	0.926	0.19
126_I	133_I	0.924	0.19
152_T	188_I	0.920	0.19
61_E	75_T	0.905	0.19
32_S	104_P	0.899	0.19
32_S	107_G	0.895	0.19
98_I	191_S	0.893	0.19
33_S	60_F	0.893	0.19
57_H	135_L	0.893	0.19
107_G	169_T	0.892	0.18
145_R	175_Q	0.890	0.18
88_Y	188_I	0.889	0.18
69_Q	116_F	0.888	0.18
35_Y	105_M	0.868	0.18
132_P	156_A	0.866	0.18
77_V	80_A	0.861	0.18
42_S	50_L	0.857	0.18
156_A	179_L	0.856	0.18
79_H	107_G	0.856	0.18
81_Y	173_A	0.853	0.18
78_P	88_Y	0.852	0.17
106_Y	167_A	0.849	0.17
30_G	34_E	0.849	0.17
34_E	165_D	0.846	0.17
54_L	136_I	0.846	0.17
88_Y	153_S	0.845	0.17
79_H	168_L	0.842	0.17
32_S	84_I	0.839	0.17
82_D	108_L	0.835	0.17
76_I	125_V	0.835	0.17
146_F	175_Q	0.820	0.17
99_F	170_N	0.817	0.17
33_S	80_A	0.815	0.17
56_L	156_A	0.810	0.17
28_P	103_T	0.805	0.16
102_D	187_S	0.800	0.16
81_Y	195_F	0.797	0.16
94_Q	108_L	0.788	0.16
159_V	170_N	0.782	0.16
139_F	183_K	0.779	0.16
107_G	181_F	0.772	0.16
106_Y	168_L	0.768	0.16
40_F	189_P	0.766	0.16
80_A	192_W	0.765	0.15
81_Y	152_T	0.764	0.15
26_L	54_L	0.763	0.15
135_L	151_S	0.759	0.15
59_T	150_N	0.753	0.15
156_A	165_D	0.751	0.15
28_P	37_A	0.748	0.15
65_E	147_K	0.748	0.15
52_S	80_A	0.744	0.15
45_T	178_G	0.736	0.15
89_M	129_H	0.731	0.15
132_P	152_T	0.725	0.15
156_A	167_A	0.725	0.15
42_S	53_K	0.723	0.15
169_T	172_L	0.718	0.14
78_P	186_K	0.707	0.14
152_T	192_W	0.706	0.14
111_R	144_V	0.706	0.14
25_T	28_P	0.700	0.14
68_L	90_R	0.698	0.14
72_L	75_T	0.693	0.14
59_T	197_K	0.690	0.14
96_L	115_E	0.686	0.14
24_N	82_D	0.684	0.14
78_P	132_P	0.679	0.14
59_T	62_S	0.663	0.13
106_Y	156_A	0.662	0.13
80_A	152_T	0.662	0.13
123_T	163_L	0.658	0.13
88_Y	195_F	0.655	0.13
188_I	195_F	0.654	0.13
76_I	168_L	0.654	0.13
88_Y	106_Y	0.651	0.13
114_F	158_K	0.647	0.13
76_I	149_V	0.644	0.13
145_R	163_L	0.639	0.13
81_Y	153_S	0.638	0.13
35_Y	189_P	0.638	0.13
87_F	136_I	0.634	0.13
99_F	149_V	0.633	0.13
32_S	89_M	0.632	0.13
79_H	127_V	0.631	0.13
104_P	152_T	0.628	0.13
41_I	52_S	0.626	0.13
69_Q	143_D	0.625	0.13
80_A	195_F	0.624	0.13
30_G	56_L	0.617	0.13
103_T	155_A	0.616	0.13
23_V	69_Q	0.615	0.12
147_K	154_Q	0.613	0.12
60_F	195_F	0.612	0.12
27_G	31_T	0.612	0.12
106_Y	192_W	0.611	0.12
77_V	195_F	0.610	0.12
63_C	67_T	0.608	0.12
54_L	105_M	0.607	0.12
23_V	175_Q	0.606	0.12
103_T	162_G	0.602	0.12
71_P	136_I	0.595	0.12
104_P	192_W	0.594	0.12
135_L	190_M	0.591	0.12
27_G	192_W	0.590	0.12
79_H	88_Y	0.590	0.12
67_T	73_E	0.583	0.12
55_S	110_V	0.582	0.12
104_P	126_I	0.579	0.12
34_E	156_A	0.575	0.12
69_Q	157_R	0.570	0.12
28_P	36_A	0.569	0.12
167_A	195_F	0.567	0.12
174_R	179_L	0.565	0.12
103_T	130_P	0.565	0.12
129_H	153_S	0.564	0.12
28_P	156_A	0.561	0.12
135_L	169_T	0.559	0.12
55_S	92_D	0.557	0.11
102_D	143_D	0.553	0.11
67_T	197_K	0.552	0.11
23_V	182_V	0.551	0.11
29_E	53_K	0.548	0.11
89_M	195_F	0.542	0.11
53_K	142_K	0.541	0.11
63_C	174_R	0.540	0.11
145_R	178_G	0.536	0.11
63_C	75_T	0.536	0.11
22_T	147_K	0.533	0.11
24_N	75_T	0.526	0.11
67_T	142_K	0.524	0.11
51_N	58_D	0.523	0.11
53_K	145_R	0.523	0.11
57_H	134_N	0.521	0.11
30_G	127_V	0.519	0.11
79_H	98_I	0.517	0.11
107_G	151_S	0.517	0.11
84_I	107_G	0.516	0.11
89_M	132_P	0.516	0.11
170_N	174_R	0.514	0.11
93_L	108_L	0.512	0.11
168_L	176_K	0.503	0.11
157_R	182_V	0.501	0.11
88_Y	167_A	0.500	0.11

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3mwbA	3	0.848	99.8	0.711	Contact Map
2qmxA	3	0.8235	99.8	0.717	Contact Map
4lubA	2	0.4608	99.8	0.721	Contact Map
3luyA	2	0.8775	99.7	0.724	Contact Map
2qmwA	2	0.8382	99.7	0.731	Contact Map
2pfzA	1	0.8775	94	0.913	Contact Map
4pddA	1	0.8824	93.9	0.913	Contact Map
4magA	1	0.8824	93.8	0.914	Contact Map
3n5lA	2	0.8824	93.2	0.916	Contact Map
4gotA	1	0.8725	92.8	0.917	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0074 seconds.