DLTC - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DLTC - D-alanine--poly(phosphoribitol) ligase subunit 2

UniProt:	P39579	Sequences: MDFKQEVLDVLAEVCQDDIVKENPDIEIFEEGLLDSFGTVELLLAIENRFDILVPITEFDRDVWNTPNNIVNQLSELK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	78 (73)
Sequences:	204 (132)
Seq/√Len:	15.4

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
27_E	65_N	5.806	1.00
4_K	75_S	2.927	0.98
25_D	68_N	2.699	0.96
12_A	21_K	2.520	0.94
4_K	24_P	2.273	0.91
6_E	50_F	2.112	0.87
13_E	62_D	1.999	0.84
73_Q	76_E	1.945	0.82
63_V	73_Q	1.822	0.77
45_A	49_R	1.734	0.74
15_C	41_E	1.481	0.61
6_E	49_R	1.479	0.61
46_I	74_L	1.411	0.57
9_D	21_K	1.375	0.55
8_L	71_V	1.340	0.53
12_A	31_E	1.318	0.52
27_E	34_L	1.317	0.52
46_I	69_N	1.300	0.51
39_T	59_F	1.276	0.50
59_F	64_W	1.254	0.48
10_V	49_R	1.212	0.46
17_D	22_E	1.200	0.45
45_A	48_N	1.192	0.45
24_P	68_N	1.191	0.45
37_F	56_I	1.181	0.44
27_E	30_E	1.178	0.44
29_F	61_R	1.173	0.44
3_F	16_Q	1.129	0.41
54_V	59_F	1.114	0.41
52_I	74_L	1.102	0.40
61_R	64_W	1.085	0.39
60_D	63_V	1.085	0.39
32_G	38_G	1.084	0.39
37_F	74_L	1.078	0.39
42_L	48_N	1.046	0.37
39_T	56_I	1.021	0.36
4_K	71_V	1.017	0.35
39_T	64_W	1.010	0.35
8_L	13_E	1.007	0.35
25_D	30_E	1.002	0.35
43_L	51_D	0.991	0.34
34_L	54_V	0.990	0.34
32_G	40_V	0.965	0.33
29_F	38_G	0.962	0.33
3_F	7_V	0.945	0.32
4_K	73_Q	0.932	0.31
10_V	45_A	0.930	0.31
40_V	56_I	0.919	0.30
7_V	29_F	0.915	0.30
7_V	46_I	0.910	0.30
47_E	53_L	0.890	0.29
21_K	24_P	0.876	0.28
55_P	59_F	0.824	0.26
17_D	21_K	0.823	0.26
56_I	59_F	0.808	0.25
29_F	39_T	0.796	0.25
41_E	57_T	0.777	0.24
42_L	67_P	0.766	0.24
11_L	73_Q	0.761	0.23
29_F	32_G	0.757	0.23
17_D	23_N	0.750	0.23
44_L	71_V	0.747	0.23
30_E	51_D	0.746	0.23
69_N	74_L	0.744	0.23
22_E	51_D	0.744	0.23
56_I	64_W	0.741	0.23
9_D	49_R	0.737	0.22
15_C	33_L	0.730	0.22
10_V	46_I	0.728	0.22
16_Q	61_R	0.710	0.21
40_V	44_L	0.709	0.21
49_R	52_I	0.694	0.21
15_C	56_I	0.692	0.21
3_F	23_N	0.689	0.21
44_L	47_E	0.677	0.20
20_V	66_T	0.660	0.20
44_L	62_D	0.648	0.19
50_F	65_N	0.646	0.19
59_F	67_P	0.642	0.19
41_E	50_F	0.637	0.19
28_I	57_T	0.637	0.19
26_I	31_E	0.635	0.19
37_F	63_V	0.630	0.19
69_N	72_N	0.626	0.18
14_V	18_D	0.622	0.18
42_L	46_I	0.616	0.18
41_E	47_E	0.615	0.18
72_N	75_S	0.606	0.18
65_N	69_N	0.604	0.18
8_L	31_E	0.597	0.17
54_V	64_W	0.589	0.17
21_K	26_I	0.584	0.17
8_L	22_E	0.571	0.17
3_F	75_S	0.570	0.17
28_I	70_I	0.568	0.16
15_C	28_I	0.549	0.16
3_F	62_D	0.534	0.15
55_P	64_W	0.534	0.15
9_D	30_E	0.529	0.15
22_E	26_I	0.529	0.15
55_P	73_Q	0.529	0.15
7_V	59_F	0.528	0.15
20_V	51_D	0.527	0.15
42_L	62_D	0.519	0.15
8_L	42_L	0.516	0.15
48_N	52_I	0.513	0.15
44_L	48_N	0.512	0.15
23_N	31_E	0.508	0.15
59_F	73_Q	0.508	0.15
38_G	70_I	0.500	0.14

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4bpfA	1	1	99.4	0.575	Contact Map
1dv5A	1	1	99.2	0.61	Contact Map
2lkiA	1	0.9872	99.1	0.635	Contact Map
2jq4A	1	0.9487	98.8	0.668	Contact Map
2lmlA	1	0.9744	98.7	0.685	Contact Map
4h2wC	1	0.9744	98.5	0.7	Contact Map
2cgqA	1	0.9359	98.5	0.705	Contact Map
2kw2A	1	1	98.4	0.711	Contact Map
4dxeH	2	0.9487	98.4	0.712	Contact Map
1vkuA	1	0.9615	98.4	0.714	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0048 seconds.