CSPC - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

CSPC - Cold shock protein CspC

UniProt:	P39158	Sequences: MEQGTVKWFNAEKGFGFIERENGDDVFVHFSAIQSDGFKSLDEGQKVSFDVEQGARGAQAANVQKA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	66 (62)
Sequences:	4101 (1565)
Seq/√Len:	198.8

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
28_V	63_V	3.661	1.00
52_E	61_A	3.278	1.00
50_D	62_N	2.770	1.00
48_S	64_Q	2.255	1.00
11_A	42_D	2.074	1.00
21_E	46_K	2.069	1.00
5_T	46_K	2.020	1.00
3_Q	48_S	2.009	1.00
3_Q	46_K	1.853	1.00
34_Q	64_Q	1.848	1.00
20_R	24_D	1.746	1.00
53_Q	58_A	1.685	1.00
54_G	57_G	1.631	1.00
42_D	45_Q	1.613	1.00
32_A	61_A	1.587	1.00
28_V	41_L	1.566	1.00
11_A	38_F	1.549	1.00
20_R	23_G	1.495	1.00
54_G	59_Q	1.471	1.00
34_Q	62_N	1.430	1.00
20_R	49_F	1.335	1.00
11_A	40_S	1.307	1.00
26_V	51_V	1.301	1.00
33_I	38_F	1.224	1.00
5_T	19_E	1.217	1.00
33_I	39_K	1.209	1.00
3_Q	21_E	1.200	1.00
54_G	58_A	1.149	1.00
9_F	30_F	1.147	1.00
30_F	39_K	1.119	1.00
51_V	58_A	1.096	1.00
24_D	58_A	1.066	1.00
32_A	52_E	0.976	0.99
4_G	18_I	0.962	0.99
41_L	47_V	0.945	0.99
18_I	49_F	0.938	0.99
52_E	59_Q	0.912	0.99
32_A	62_N	0.870	0.99
49_F	60_A	0.827	0.98
33_I	36_D	0.820	0.98
4_G	60_A	0.807	0.98
8_W	28_V	0.804	0.98
19_E	44_G	0.788	0.98
18_I	60_A	0.786	0.98
30_F	33_I	0.781	0.98
10_N	27_F	0.755	0.97
35_S	39_K	0.692	0.95
13_K	37_G	0.685	0.95
5_T	21_E	0.675	0.94
36_D	64_Q	0.658	0.94
30_F	56_R	0.656	0.93
7_K	25_D	0.655	0.93
20_R	51_V	0.645	0.93
18_I	47_V	0.642	0.93
13_K	25_D	0.631	0.92
33_I	63_V	0.631	0.92
17_F	44_G	0.627	0.92
7_K	13_K	0.624	0.92
43_E	59_Q	0.619	0.91
14_G	25_D	0.616	0.91
24_D	53_Q	0.597	0.90
33_I	41_L	0.597	0.90
4_G	49_F	0.588	0.89
30_F	38_F	0.583	0.89
41_L	45_Q	0.581	0.89
40_S	45_Q	0.576	0.88
12_E	59_Q	0.570	0.88
32_A	49_F	0.567	0.87
35_S	38_F	0.564	0.87
26_V	52_E	0.564	0.87
8_W	13_K	0.563	0.87
8_W	43_E	0.562	0.87
50_D	61_A	0.560	0.87
36_D	39_K	0.560	0.87
51_V	61_A	0.559	0.87
12_E	45_Q	0.558	0.87
16_G	28_V	0.557	0.86
18_I	28_V	0.545	0.85
26_V	60_A	0.544	0.85
38_F	42_D	0.534	0.84
27_F	45_Q	0.534	0.84
14_G	33_I	0.525	0.83
15_F	41_L	0.520	0.82
10_N	15_F	0.518	0.82
17_F	29_H	0.515	0.82
55_A	58_A	0.512	0.82
7_K	34_Q	0.510	0.81
4_G	31_S	0.510	0.81
19_E	26_V	0.509	0.81
15_F	26_V	0.506	0.81
36_D	47_V	0.502	0.80
53_Q	59_Q	0.501	0.80
15_F	35_S	0.500	0.80

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2lxjA	1	1	99.8	0.146	Contact Map
1c9oA	2	1	99.7	0.155	Contact Map
3camA	2	1	99.7	0.158	Contact Map
3a0jA	1	1	99.7	0.167	Contact Map
1g6pA	1	0.9848	99.7	0.18	Contact Map
3i2zB	2	1	99.7	0.183	Contact Map
2lssA	1	1	99.7	0.187	Contact Map
2mqhA	1	0.9697	99.7	0.191	Contact Map
3uljA	3	1	99.7	0.194	Contact Map
1h95A	1	1	99.7	0.206	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.005 seconds.