YWLG - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YWLG - UPF0340 protein YwlG

UniProt:	P39157	Sequences: MNELKQTWKTMLSEFQDQAELKQDQLFVLGCSTSEVAGSRIGTSGSVDIAESIYSGLAELREKTGIHLAFQCCEHLNRALVVEAETAKLFRLPTVSAVPVPKAGGAMASYAFKQMKSPVLVETIQADAGIDIGDTFIGMHLKPVAVPVRVSQNSLGSAHVTLARTRPKLIGGVRAVYECE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	180 (175)
Sequences:	557 (399)
Seq/√Len:	30.1

BACSU - YWLG

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
84_A	117_S	5.068	1.00
134_D	159_H	4.734	1.00
36_V	53_I	4.351	1.00
123_T	143_P	4.018	1.00
72_C	76_L	3.712	1.00
97_A	120_L	3.286	1.00
141_L	165_T	2.856	1.00
81_V	120_L	2.724	1.00
150_V	162_L	2.621	1.00
21_L	128_A	2.593	1.00
14_E	151_S	2.481	0.99
67_H	86_T	2.446	0.99
11_M	155_L	2.382	0.99
82_V	92_L	2.109	0.98
37_A	49_I	2.100	0.98
90_F	127_D	2.061	0.98
154_S	159_H	2.009	0.97
22_K	88_K	1.903	0.96
4_L	155_L	1.901	0.96
26_L	92_L	1.860	0.96
5_K	55_S	1.790	0.94
26_L	124_I	1.742	0.94
173_V	178_E	1.696	0.93
25_Q	127_D	1.650	0.92
50_A	110_Y	1.639	0.91
11_M	160_V	1.632	0.91
41_I	135_T	1.627	0.91
134_D	161_T	1.592	0.90
58_A	62_E	1.564	0.89
141_L	145_A	1.557	0.89
136_F	159_H	1.524	0.88
69_A	82_V	1.508	0.87
5_K	56_G	1.493	0.87
19_A	164_R	1.483	0.87
83_E	118_P	1.431	0.85
14_E	150_V	1.401	0.83
26_L	86_T	1.381	0.82
15_F	150_V	1.371	0.82
79_A	170_I	1.347	0.81
80_L	140_H	1.347	0.81
19_A	24_D	1.312	0.79
87_A	94_T	1.311	0.79
86_T	90_F	1.309	0.79
33_T	107_M	1.297	0.78
22_K	84_A	1.284	0.77
136_F	161_T	1.275	0.77
136_F	145_A	1.267	0.76
72_C	81_V	1.256	0.76
96_S	169_L	1.256	0.76
15_F	162_L	1.245	0.75
141_L	163_A	1.244	0.75
40_R	43_T	1.236	0.75
51_E	113_K	1.231	0.74
136_F	163_A	1.228	0.74
72_C	108_A	1.223	0.74
87_A	121_V	1.202	0.72
54_Y	58_A	1.188	0.72
12_L	60_L	1.183	0.71
96_S	146_V	1.181	0.71
57_L	68_L	1.171	0.70
15_F	19_A	1.153	0.69
15_F	18_Q	1.141	0.68
39_S	43_T	1.132	0.68
15_F	27_F	1.132	0.68
101_P	109_S	1.129	0.68
145_A	163_A	1.124	0.67
81_V	108_A	1.120	0.67
67_H	85_E	1.114	0.67
69_A	124_I	1.111	0.66
84_A	94_T	1.102	0.66
76_L	81_V	1.094	0.65
31_C	107_M	1.093	0.65
7_T	152_Q	1.084	0.64
13_S	63_K	1.076	0.64
28_V	80_L	1.072	0.63
65_G	128_A	1.068	0.63
83_E	115_M	1.067	0.63
61_R	66_I	1.050	0.62
110_Y	114_Q	1.024	0.60
10_T	152_Q	1.020	0.60
148_V	164_R	1.008	0.59
53_I	57_L	1.008	0.59
50_A	107_M	0.984	0.57
134_D	154_S	0.983	0.57
39_S	44_S	0.981	0.57
70_F	107_M	0.979	0.56
85_E	116_K	0.975	0.56
58_A	61_R	0.964	0.55
26_L	90_F	0.964	0.55
50_A	101_P	0.961	0.55
115_M	118_P	0.958	0.55
96_S	178_E	0.951	0.54
100_V	169_L	0.943	0.54
122_E	168_K	0.943	0.54
9_K	59_E	0.939	0.53
130_I	162_L	0.937	0.53
8_W	56_G	0.934	0.53
62_E	116_K	0.923	0.52
100_V	109_S	0.917	0.52
55_S	114_Q	0.914	0.51
90_F	94_T	0.910	0.51
21_L	25_Q	0.906	0.51
23_Q	65_G	0.898	0.50
41_I	134_D	0.896	0.50
85_E	89_L	0.891	0.49
93_P	168_K	0.890	0.49
45_G	107_M	0.889	0.49
127_D	142_K	0.888	0.49
10_T	151_S	0.888	0.49
93_P	125_Q	0.887	0.49
11_M	150_V	0.880	0.49
8_W	60_L	0.878	0.48
50_A	54_Y	0.878	0.48
153_N	161_T	0.876	0.48
67_H	89_L	0.873	0.48
35_E	149_R	0.872	0.48
145_A	165_T	0.871	0.48
12_L	57_L	0.860	0.47
45_G	50_A	0.844	0.46
45_G	100_V	0.844	0.46
23_Q	66_I	0.835	0.45
143_P	168_K	0.834	0.45
7_T	49_I	0.834	0.45
54_Y	114_Q	0.832	0.45
27_F	66_I	0.828	0.44
27_F	61_R	0.827	0.44
100_V	176_V	0.826	0.44
61_R	70_F	0.824	0.44
60_L	66_I	0.823	0.44
81_V	112_F	0.821	0.44
29_L	70_F	0.814	0.43
84_A	88_K	0.813	0.43
154_S	157_S	0.807	0.43
15_F	148_V	0.797	0.42
50_A	56_G	0.793	0.42
82_V	86_T	0.789	0.41
52_S	148_V	0.779	0.41
4_L	52_S	0.778	0.41
59_E	63_K	0.768	0.40
81_V	146_V	0.766	0.40
98_V	176_V	0.752	0.39
91_R	125_Q	0.746	0.38
33_T	46_S	0.744	0.38
169_L	173_V	0.742	0.38
81_V	97_A	0.738	0.38
130_I	150_V	0.734	0.37
45_G	101_P	0.728	0.37
125_Q	143_P	0.727	0.37
86_T	92_L	0.727	0.37
67_H	90_F	0.715	0.36
11_M	152_Q	0.711	0.36
44_S	109_S	0.710	0.35
96_S	114_Q	0.709	0.35
61_R	64_T	0.706	0.35
33_T	101_P	0.700	0.35
13_S	60_L	0.700	0.35
54_Y	107_M	0.697	0.35
108_A	141_L	0.695	0.34
54_Y	115_M	0.690	0.34
39_S	157_S	0.689	0.34
54_Y	110_Y	0.688	0.34
65_G	85_E	0.687	0.34
8_W	33_T	0.686	0.34
28_V	128_A	0.684	0.34
106_A	127_D	0.683	0.34
98_V	160_V	0.683	0.34
169_L	178_E	0.682	0.33
45_G	110_Y	0.681	0.33
82_V	91_R	0.680	0.33
16_Q	64_T	0.680	0.33
9_K	56_G	0.677	0.33
72_C	97_A	0.675	0.33
92_L	121_V	0.674	0.33
33_T	110_Y	0.671	0.33
18_Q	97_A	0.671	0.33
41_I	149_R	0.670	0.33
29_L	57_L	0.670	0.33
68_L	83_E	0.669	0.33
94_T	119_V	0.667	0.32
9_K	33_T	0.657	0.32
48_D	51_E	0.654	0.31
45_G	109_S	0.652	0.31
76_L	100_V	0.641	0.31
101_P	106_A	0.639	0.30
31_C	150_V	0.637	0.30
109_S	113_K	0.633	0.30
39_S	102_K	0.618	0.29
57_L	60_L	0.615	0.29
56_G	60_L	0.614	0.29
22_K	25_Q	0.614	0.29
58_A	115_M	0.613	0.29
68_L	118_P	0.612	0.29
93_P	97_A	0.610	0.29
8_W	31_C	0.609	0.28
26_L	67_H	0.606	0.28
87_A	119_V	0.600	0.28
11_M	130_I	0.597	0.28
23_Q	59_E	0.596	0.28
51_E	124_I	0.596	0.28
136_F	165_T	0.595	0.28
69_A	136_F	0.594	0.28
96_S	120_L	0.593	0.27
70_F	110_Y	0.591	0.27
19_A	23_Q	0.590	0.27
5_K	9_K	0.588	0.27
97_A	115_M	0.587	0.27
35_E	41_I	0.587	0.27
9_K	13_S	0.587	0.27
130_I	160_V	0.587	0.27
11_M	162_L	0.586	0.27
43_T	102_K	0.583	0.27
8_W	155_L	0.582	0.27
6_Q	9_K	0.579	0.27
70_F	108_A	0.578	0.27
14_E	90_F	0.575	0.26
38_G	167_P	0.573	0.26
31_C	135_T	0.573	0.26
97_A	168_K	0.573	0.26
80_L	106_A	0.567	0.26
86_T	89_L	0.564	0.26
5_K	23_Q	0.563	0.26
26_L	80_L	0.557	0.25
136_F	154_S	0.557	0.25
38_G	50_A	0.556	0.25
36_V	50_A	0.553	0.25
31_C	54_Y	0.552	0.25
16_Q	21_L	0.549	0.25
19_A	69_A	0.548	0.25
52_S	56_G	0.546	0.25
6_Q	10_T	0.546	0.25
49_I	141_L	0.546	0.25
87_A	92_L	0.545	0.25
14_E	98_V	0.543	0.24
7_T	10_T	0.542	0.24
106_A	112_F	0.541	0.24
9_K	116_K	0.538	0.24
126_A	160_V	0.537	0.24
12_L	20_E	0.537	0.24
70_F	111_A	0.535	0.24
23_Q	148_V	0.534	0.24
107_M	169_L	0.534	0.24
10_T	17_D	0.533	0.24
10_T	14_E	0.532	0.24
8_W	15_F	0.530	0.24
5_K	59_E	0.529	0.24
31_C	66_I	0.528	0.24
72_C	145_A	0.528	0.24
97_A	121_V	0.527	0.23
12_L	150_V	0.525	0.23
45_G	61_R	0.524	0.23
127_D	165_T	0.523	0.23
29_L	72_C	0.523	0.23
43_T	46_S	0.517	0.23
39_S	117_S	0.516	0.23
48_D	178_E	0.515	0.23
81_V	169_L	0.510	0.23
101_P	108_A	0.509	0.22
123_T	145_A	0.504	0.22
106_A	170_I	0.503	0.22
92_L	127_D	0.503	0.22
5_K	168_K	0.501	0.22
25_Q	88_K	0.500	0.22

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1v8dA	5	0.9833	100	0.048	Contact Map
4a2aA	1	0.95	31.3	0.963	Contact Map
2qfyA	2	0.3167	21.9	0.966	Contact Map
2jrxA	2	0.4167	20.9	0.966	Contact Map
2jpqA	2	0.4167	19.8	0.967	Contact Map
3wqtA	2	0.9222	19.2	0.967	Contact Map
2jr2A	2	0.3778	14.4	0.969	Contact Map
2xdqA	1	0.95	13.5	0.969	Contact Map
3pvjA	3	0.3333	12.6	0.969	Contact Map
4umxA	2	0.3056	12.4	0.969	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0068 seconds.