YWLF - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YWLF - Putative sugar phosphate isomerase YwlF

UniProt:	P39156	Sequences: MKVAIASDHGGVHIRNEIKELMDELQIEYIDMGCDCGSGSVDYPDYAFPVAEKVVSGEVDRGILICGTGIGMSISANKVKGIRCALAHDTFSAKATREHNDTNILAMGERVIGPGLAREIAKIWLTTEFTGGRHQTRIGKISDYEEKNL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	149 (142)
Sequences:	3517 (2132)
Seq/√Len:	178.9

ECOLI - RPIB
BACSU - YWLF

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
45_D	140_K	3.431	1.00
135_Q	139_G	3.358	1.00
21_L	122_K	2.598	1.00
16_N	19_K	2.345	1.00
25_L	122_K	2.268	1.00
17_E	114_P	2.135	1.00
4_A	32_M	2.086	1.00
90_T	119_E	2.051	1.00
84_C	106_A	2.048	1.00
32_M	53_K	2.006	1.00
94_K	98_E	1.948	1.00
98_E	130_T	1.894	1.00
4_A	59_V	1.881	1.00
6_A	50_V	1.875	1.00
36_C	39_G	1.805	1.00
85_A	96_T	1.771	1.00
19_K	23_D	1.765	1.00
88_H	92_S	1.738	1.00
14_I	117_A	1.716	1.00
67_G	110_R	1.693	1.00
17_E	118_R	1.688	1.00
113_G	116_L	1.666	1.00
48_F	144_Y	1.665	1.00
11_G	65_I	1.654	1.00
13_H	38_S	1.620	1.00
53_K	58_E	1.596	1.00
13_H	109_E	1.580	1.00
64_L	76_A	1.472	1.00
42_D	136_T	1.448	1.00
2_K	28_E	1.446	1.00
30_I	59_V	1.445	1.00
20_E	23_D	1.436	1.00
122_K	126_T	1.429	1.00
20_E	24_E	1.429	1.00
25_L	126_T	1.400	1.00
4_A	53_K	1.397	1.00
55_V	79_V	1.392	1.00
51_A	82_I	1.384	1.00
89_D	92_S	1.365	1.00
48_F	52_E	1.362	1.00
47_A	72_M	1.362	1.00
98_E	127_T	1.360	1.00
91_F	95_A	1.334	1.00
64_L	72_M	1.320	1.00
64_L	106_A	1.310	1.00
102_T	124_W	1.295	1.00
12_V	16_N	1.293	1.00
15_R	31_D	1.282	1.00
48_F	79_V	1.276	1.00
10_G	110_R	1.271	1.00
52_E	56_S	1.267	1.00
94_K	119_E	1.267	1.00
21_L	25_L	1.248	1.00
23_D	29_Y	1.237	1.00
21_L	118_R	1.232	1.00
63_I	121_A	1.221	1.00
55_V	82_I	1.193	1.00
139_G	143_D	1.191	1.00
70_I	85_A	1.158	1.00
78_K	142_S	1.152	1.00
115_G	118_R	1.141	1.00
50_V	62_G	1.136	1.00
90_T	123_I	1.126	1.00
84_C	104_I	1.126	1.00
95_A	98_E	1.117	1.00
76_A	84_C	1.095	1.00
73_S	106_A	1.089	1.00
5_I	19_K	1.086	1.00
96_T	124_W	1.081	1.00
91_F	111_V	1.069	1.00
47_A	64_L	1.054	1.00
96_T	102_T	1.051	1.00
73_S	86_L	1.050	1.00
40_S	136_T	1.039	1.00
66_C	72_M	1.038	1.00
18_I	121_A	1.035	1.00
123_I	127_T	1.034	1.00
61_R	124_W	1.024	0.99
87_A	105_L	1.021	0.99
94_K	123_I	1.008	0.99
4_A	57_G	1.002	0.99
120_I	123_I	1.001	0.99
61_R	97_R	0.997	0.99
6_A	32_M	0.994	0.99
93_A	120_I	0.979	0.99
82_I	104_I	0.974	0.99
57_G	60_D	0.970	0.99
50_V	64_L	0.960	0.99
51_A	104_I	0.933	0.99
41_V	46_Y	0.921	0.99
72_M	106_A	0.920	0.99
14_I	109_E	0.917	0.99
14_I	114_P	0.910	0.99
79_V	144_Y	0.906	0.99
132_G	135_Q	0.901	0.99
105_L	120_I	0.899	0.99
88_H	112_I	0.886	0.98
87_A	120_I	0.885	0.98
101_D	129_F	0.882	0.98
12_V	36_C	0.882	0.98
7_S	34_C	0.857	0.98
51_A	55_V	0.843	0.98
91_F	113_G	0.843	0.98
107_M	112_I	0.838	0.98
4_A	60_D	0.835	0.98
73_S	84_C	0.834	0.98
49_P	53_K	0.831	0.98
17_E	20_E	0.828	0.98
108_G	111_V	0.828	0.98
131_G	135_Q	0.827	0.98
30_I	53_K	0.819	0.97
139_G	142_S	0.819	0.97
138_I	142_S	0.817	0.97
63_I	105_L	0.815	0.97
18_I	118_R	0.814	0.97
31_D	35_D	0.805	0.97
5_I	22_M	0.800	0.97
17_E	21_L	0.800	0.97
21_L	24_E	0.797	0.97
107_M	121_A	0.795	0.97
6_A	46_Y	0.793	0.97
42_D	140_K	0.792	0.97
7_S	11_G	0.790	0.97
97_R	124_W	0.786	0.97
5_I	29_Y	0.780	0.97
50_V	104_I	0.774	0.96
7_S	16_N	0.773	0.96
32_M	59_V	0.772	0.96
97_R	127_T	0.767	0.96
112_I	120_I	0.765	0.96
51_A	79_V	0.759	0.96
18_I	65_I	0.756	0.96
119_E	122_K	0.753	0.96
16_N	20_E	0.747	0.96
34_C	46_Y	0.746	0.96
99_H	137_R	0.740	0.95
43_Y	134_H	0.739	0.95
30_I	35_D	0.738	0.95
112_I	117_A	0.714	0.94
3_V	27_I	0.709	0.94
4_A	50_V	0.695	0.94
6_A	64_L	0.694	0.94
119_E	123_I	0.691	0.93
52_E	144_Y	0.691	0.93
75_S	141_I	0.686	0.93
5_I	65_I	0.683	0.93
89_D	116_L	0.682	0.93
23_D	28_E	0.681	0.93
134_H	137_R	0.681	0.93
74_I	102_T	0.671	0.92
54_V	81_G	0.668	0.92
72_M	75_S	0.667	0.92
2_K	30_I	0.664	0.92
42_D	45_D	0.662	0.92
7_S	12_V	0.662	0.92
53_K	59_V	0.661	0.92
129_F	135_Q	0.660	0.92
3_V	125_L	0.659	0.92
34_C	41_V	0.655	0.91
112_I	116_L	0.653	0.91
99_H	134_H	0.650	0.91
70_I	96_T	0.646	0.91
90_T	120_I	0.645	0.91
70_I	73_S	0.643	0.91
99_H	133_R	0.640	0.91
133_R	137_R	0.625	0.89
92_S	108_G	0.617	0.89
136_T	139_G	0.615	0.89
30_I	58_E	0.614	0.89
93_A	105_L	0.611	0.88
61_R	101_D	0.603	0.88
114_P	118_R	0.603	0.88
6_A	15_R	0.601	0.88
95_A	99_H	0.600	0.87
90_T	94_K	0.598	0.87
69_G	86_L	0.596	0.87
22_M	25_L	0.594	0.87
66_C	73_S	0.594	0.87
45_D	49_P	0.593	0.87
70_I	86_L	0.592	0.87
92_S	111_V	0.591	0.87
78_K	141_I	0.588	0.86
88_H	107_M	0.588	0.86
44_P	140_K	0.575	0.85
34_C	40_S	0.573	0.85
62_G	104_I	0.573	0.85
47_A	51_A	0.566	0.84
10_G	67_G	0.565	0.84
47_A	66_C	0.560	0.84
135_Q	138_I	0.558	0.83
2_K	60_D	0.557	0.83
101_D	142_S	0.555	0.83
9_H	42_D	0.553	0.83
7_S	31_D	0.552	0.83
101_D	135_Q	0.549	0.82
48_F	142_S	0.548	0.82
57_G	61_R	0.548	0.82
83_R	142_S	0.545	0.82
55_V	80_K	0.545	0.82
52_E	55_V	0.543	0.82
116_L	120_I	0.539	0.81
70_I	92_S	0.530	0.80
70_I	74_I	0.527	0.80
13_H	17_E	0.520	0.79
75_S	79_V	0.516	0.78
22_M	121_A	0.515	0.78
64_L	104_I	0.514	0.78
24_E	118_R	0.506	0.77
86_L	92_S	0.506	0.77
54_V	79_V	0.505	0.77
25_L	118_R	0.505	0.77
53_K	56_S	0.504	0.77
5_I	63_I	0.500	0.76

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3s5pA	4	0.8859	100	0.022	Contact Map
3he8A	2	0.9933	100	0.027	Contact Map
4lflB	3	0.9933	100	0.027	Contact Map
3ph3A	2	0.9866	100	0.028	Contact Map
2vvrA	2	0.9799	100	0.033	Contact Map
2vvpA	2	0.9933	100	0.037	Contact Map
3sgwA	4	1	100	0.039	Contact Map
3k7pA	4	0.9933	100	0.041	Contact Map
1o1xA	3	0.9597	100	0.051	Contact Map
4lflA	2	0.9463	100	0.065	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0063 seconds.