PAP - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

PAP - Protein-arginine-phosphatase

UniProt:	P39155	Sequences: MDIIFVCTGNTCRSPMAEALFKSIAEREGLNVNVRSAGVFASPNGKATPHAVEALFEKHIALNHVSSPLTEELMESADLVLAMTHQHKQIIASQFGRYRDKVFTLKEYVTGSHGDVLDPFGGSIDIYKQTRDELEELLRQLAKQLKKDRR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	150 (144)
Sequences:	4713 (3565)
Seq/√Len:	297.0

ECOLI - WZB ETP
BACSU - PAP YFKJ ARSC
HALSA - ARSC

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
24_I	139_R	3.386	1.00
23_S	27_R	3.263	1.00
18_E	22_K	2.947	1.00
69_L	91_I	2.886	1.00
82_A	91_I	2.423	1.00
117_L	133_E	2.409	1.00
2_D	33_N	2.381	1.00
55_L	62_L	2.130	1.00
16_M	51_A	2.120	1.00
8_T	87_H	2.088	1.00
85_H	115_D	2.062	1.00
57_E	128_K	1.902	1.00
122_G	126_I	1.839	1.00
5_F	21_F	1.809	1.00
4_I	37_A	1.769	1.00
35_R	67_S	1.760	1.00
54_A	128_K	1.730	1.00
105_L	138_L	1.648	1.00
88_K	92_A	1.593	1.00
16_M	55_L	1.571	1.00
103_F	108_Y	1.544	1.00
58_K	135_E	1.524	1.00
72_E	76_S	1.508	1.00
3_I	21_F	1.506	1.00
33_N	76_S	1.501	1.00
47_A	64_H	1.493	1.00
82_A	88_K	1.478	1.00
25_A	34_V	1.477	1.00
24_I	135_E	1.459	1.00
35_R	77_A	1.458	1.00
54_A	57_E	1.452	1.00
58_K	131_R	1.451	1.00
8_T	40_F	1.420	1.00
39_V	90_I	1.397	1.00
20_L	131_R	1.382	1.00
20_L	134_L	1.378	1.00
67_S	73_L	1.378	1.00
24_I	138_L	1.378	1.00
46_K	52_V	1.364	1.00
129_Q	133_E	1.363	1.00
25_A	32_V	1.363	1.00
54_A	131_R	1.359	1.00
21_F	34_V	1.350	1.00
105_L	134_L	1.325	1.00
85_H	104_T	1.317	1.00
58_K	132_D	1.312	1.00
47_A	52_V	1.283	1.00
20_L	138_L	1.280	1.00
19_A	62_L	1.268	1.00
53_E	124_I	1.230	1.00
103_F	107_E	1.223	1.00
106_K	109_V	1.194	1.00
47_A	62_L	1.192	1.00
52_V	62_L	1.184	1.00
60_I	135_E	1.180	1.00
106_K	133_E	1.179	1.00
22_K	34_V	1.156	1.00
88_K	102_V	1.148	1.00
92_A	102_V	1.143	1.00
104_T	115_D	1.129	1.00
41_A	68_P	1.126	1.00
37_A	67_S	1.113	1.00
23_S	26_E	1.109	1.00
19_A	60_I	1.103	1.00
123_S	126_I	1.097	1.00
28_E	143_K	1.095	1.00
52_V	56_F	1.078	1.00
74_M	80_V	1.076	1.00
17_A	83_M	1.062	1.00
21_F	138_L	1.062	1.00
54_A	58_K	1.046	1.00
19_A	64_H	1.035	1.00
84_T	87_H	1.020	1.00
51_A	54_A	1.013	1.00
135_E	139_R	1.009	1.00
140_Q	143_K	1.007	1.00
90_I	93_S	1.001	1.00
2_D	76_S	0.999	1.00
82_A	104_T	0.996	1.00
53_E	57_E	0.992	1.00
74_M	98_Y	0.985	1.00
86_Q	90_I	0.982	1.00
71_E	94_Q	0.981	1.00
69_L	74_M	0.980	1.00
108_Y	141_L	0.979	1.00
83_M	105_L	0.965	1.00
124_I	128_K	0.963	1.00
79_L	141_L	0.962	1.00
79_L	103_F	0.950	1.00
91_I	102_V	0.950	1.00
75_E	97_R	0.944	1.00
19_A	22_K	0.935	1.00
108_Y	144_Q	0.934	1.00
24_I	27_R	0.931	1.00
81_L	141_L	0.927	1.00
57_E	124_I	0.925	1.00
90_I	94_Q	0.924	1.00
88_K	104_T	0.922	1.00
105_L	137_L	0.911	1.00
81_L	103_F	0.908	1.00
98_Y	101_K	0.904	1.00
109_V	136_E	0.903	1.00
8_T	86_Q	0.899	1.00
128_K	132_D	0.897	1.00
130_T	134_L	0.895	1.00
16_M	131_R	0.893	1.00
49_P	53_E	0.887	1.00
19_A	61_A	0.876	1.00
95_F	102_V	0.870	1.00
83_M	116_V	0.867	1.00
4_I	77_A	0.865	1.00
5_F	17_A	0.860	1.00
48_T	127_Y	0.860	1.00
81_L	108_Y	0.854	1.00
106_K	137_L	0.850	1.00
19_A	47_A	0.847	1.00
47_A	55_L	0.839	1.00
6_V	80_V	0.838	1.00
24_I	142_A	0.836	1.00
72_E	75_E	0.834	1.00
92_A	95_F	0.819	1.00
24_I	28_E	0.816	1.00
28_E	139_R	0.813	1.00
39_V	91_I	0.800	1.00
107_E	113_H	0.797	1.00
60_I	131_R	0.784	0.99
141_L	145_L	0.778	0.99
113_H	129_Q	0.774	0.99
6_V	91_I	0.773	0.99
110_T	136_E	0.768	0.99
25_A	142_A	0.767	0.99
37_A	69_L	0.765	0.99
20_L	60_I	0.759	0.99
131_R	135_E	0.755	0.99
50_H	124_I	0.746	0.99
56_F	62_L	0.743	0.99
54_A	124_I	0.737	0.99
74_M	95_F	0.737	0.99
2_D	77_A	0.720	0.99
46_K	64_H	0.719	0.99
46_K	65_V	0.717	0.99
40_F	68_P	0.711	0.99
16_M	54_A	0.709	0.99
74_M	91_I	0.707	0.99
108_Y	140_Q	0.706	0.99
41_A	45_G	0.705	0.99
4_I	67_S	0.701	0.99
81_L	105_L	0.701	0.99
42_S	45_G	0.700	0.99
8_T	84_T	0.700	0.99
21_F	24_I	0.696	0.99
22_K	26_E	0.693	0.99
25_A	30_L	0.690	0.99
126_I	129_Q	0.688	0.99
58_K	128_K	0.676	0.98
103_F	144_Q	0.673	0.98
73_L	77_A	0.666	0.98
4_I	80_V	0.661	0.98
80_V	91_I	0.661	0.98
50_H	122_G	0.660	0.98
95_F	98_Y	0.659	0.98
104_T	107_E	0.658	0.98
71_E	75_E	0.653	0.98
109_V	140_Q	0.652	0.98
70_T	73_L	0.649	0.98
17_A	105_L	0.637	0.98
95_F	100_D	0.635	0.98
79_L	108_Y	0.634	0.98
74_M	96_G	0.632	0.97
17_A	134_L	0.623	0.97
130_T	133_E	0.617	0.97
40_F	90_I	0.616	0.97
79_L	145_L	0.611	0.97
56_F	61_A	0.608	0.97
16_M	130_T	0.602	0.97
83_M	87_H	0.595	0.96
70_T	76_S	0.594	0.96
10_N	14_S	0.589	0.96
28_E	142_A	0.582	0.96
51_A	55_L	0.582	0.96
50_H	123_S	0.579	0.96
11_T	127_Y	0.579	0.96
37_A	73_L	0.575	0.96
121_G	126_I	0.574	0.96
75_E	98_Y	0.572	0.95
22_K	63_N	0.570	0.95
134_L	138_L	0.565	0.95
55_L	60_I	0.563	0.95
67_S	77_A	0.561	0.95
35_R	76_S	0.560	0.95
106_K	115_D	0.556	0.95
2_D	35_R	0.556	0.95
18_E	64_H	0.552	0.95
8_T	90_I	0.551	0.94
116_V	133_E	0.550	0.94
109_V	141_L	0.550	0.94
45_G	66_S	0.549	0.94
21_F	141_L	0.547	0.94
48_T	120_F	0.546	0.94
95_F	101_K	0.545	0.94
126_I	130_T	0.544	0.94
19_A	63_N	0.539	0.94
20_L	135_E	0.539	0.94
116_V	137_L	0.536	0.94
5_F	138_L	0.534	0.94
98_Y	102_V	0.534	0.94
105_L	141_L	0.529	0.93
141_L	144_Q	0.527	0.93
3_I	79_L	0.522	0.93
43_P	68_P	0.516	0.92
20_L	24_I	0.515	0.92
107_E	114_G	0.510	0.92
48_T	51_A	0.507	0.92
11_T	48_T	0.505	0.92
22_K	64_H	0.503	0.91
41_A	121_G	0.500	0.91

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4etnA	1	0.98	100	0.13	Contact Map
3jviA	1	0.9867	100	0.153	Contact Map
3n8iA	1	0.9733	100	0.158	Contact Map
1d1qA	1	0.9733	100	0.16	Contact Map
4egsA	2	0.96	100	0.16	Contact Map
4picA	2	0.98	100	0.16	Contact Map
4lrqA	2	0.9733	100	0.162	Contact Map
2cwdA	1	0.96	100	0.164	Contact Map
2gi4A	1	0.9867	100	0.171	Contact Map
1u2pA	1	0.9867	100	0.171	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0066 seconds.