MNTP - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

MNTP - Putative manganese efflux pump MntP

UniProt:	P39154	Sequences: MSDLFIGELITLSIMAFALGMDAFSVGLGMGMVKLRKKQIFYIGFIIGLFHVIMPLAGMAAGNMLSGLLGVLAVYIGGALLFVLGVQMLMASFKQSEERFMSPAGPGLLLFAIGVSLDSFSVGLSLGIYGSHPLLTITLFGLFSMMLTWLGLLVGKQVQSWLGTYSEALGGIILIVFGLKLLLPI	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	185 (175)
Sequences:	1918 (1571)
Seq/√Len:	118.7

ECOLI - MNTP
BACSU - MNTP YTAF

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
78_G	182_L	4.964	1.00
52_V	141_G	4.223	1.00
87_Q	90_M	3.501	1.00
90_M	94_K	3.465	1.00
46_I	112_A	3.434	1.00
24_F	151_G	3.366	1.00
92_S	168_A	2.562	1.00
52_V	137_I	2.555	1.00
46_I	108_L	2.463	1.00
79_A	83_V	2.317	1.00
56_L	137_I	2.187	1.00
172_I	176_V	2.130	1.00
139_L	143_F	2.110	1.00
85_G	171_G	2.103	1.00
86_V	90_M	2.021	1.00
46_I	105_G	2.003	1.00
38_K	42_Y	1.916	1.00
16_A	139_L	1.892	1.00
95_Q	100_F	1.885	1.00
23_A	144_S	1.853	1.00
30_M	111_F	1.839	1.00
132_H	135_L	1.834	1.00
85_G	175_I	1.809	1.00
89_L	171_G	1.806	1.00
13_S	139_L	1.803	1.00
28_L	154_V	1.784	1.00
19_L	118_D	1.771	1.00
28_L	151_G	1.764	1.00
147_L	151_G	1.722	1.00
43_I	108_L	1.706	1.00
27_G	148_T	1.665	1.00
13_S	143_F	1.661	1.00
12_L	139_L	1.610	1.00
87_Q	91_A	1.607	1.00
35_L	40_I	1.598	1.00
12_L	136_T	1.589	1.00
17_F	147_L	1.559	1.00
42_Y	105_G	1.545	1.00
175_I	178_G	1.531	1.00
40_I	44_G	1.489	1.00
45_F	49_L	1.482	1.00
154_V	158_V	1.463	1.00
83_V	87_Q	1.436	1.00
20_G	147_L	1.418	1.00
12_L	16_A	1.391	1.00
16_A	143_F	1.367	1.00
51_H	115_V	1.355	1.00
69_L	73_A	1.330	1.00
179_L	183_L	1.326	1.00
85_G	178_G	1.322	1.00
92_S	96_S	1.311	1.00
50_F	141_G	1.300	1.00
48_G	141_G	1.296	1.00
119_S	140_F	1.294	1.00
23_A	55_P	1.283	1.00
55_P	140_F	1.279	1.00
35_L	39_Q	1.275	1.00
82_F	86_V	1.272	1.00
20_G	47_I	1.267	0.99
154_V	162_L	1.244	0.99
39_Q	103_P	1.242	0.99
24_F	125_S	1.223	0.99
40_I	152_L	1.214	0.99
49_L	53_I	1.208	0.99
39_Q	42_Y	1.186	0.99
20_G	144_S	1.184	0.99
15_M	177_F	1.177	0.99
47_I	51_H	1.177	0.99
50_F	54_M	1.176	0.99
153_L	157_Q	1.175	0.99
68_L	71_V	1.172	0.99
54_M	116_S	1.166	0.99
158_V	162_L	1.163	0.99
20_G	143_F	1.145	0.99
51_H	119_S	1.143	0.99
73_A	77_G	1.129	0.99
51_H	140_F	1.119	0.99
95_Q	98_E	1.117	0.99
70_G	73_A	1.102	0.99
77_G	181_L	1.099	0.99
48_G	145_M	1.075	0.98
10_I	71_V	1.068	0.98
15_M	126_L	1.041	0.98
157_Q	160_S	1.036	0.98
38_K	43_I	1.022	0.98
155_G	159_Q	1.010	0.97
164_T	168_A	1.009	0.97
23_A	48_G	1.001	0.97
57_A	120_F	0.996	0.97
42_Y	104_A	0.989	0.97
123_G	155_G	0.985	0.97
36_R	39_Q	0.982	0.97
144_S	148_T	0.978	0.97
66_S	70_G	0.977	0.97
77_G	115_V	0.973	0.97
133_P	137_I	0.969	0.97
18_A	21_M	0.960	0.97
92_S	95_Q	0.955	0.96
96_S	101_M	0.955	0.96
11_T	28_L	0.951	0.96
89_L	168_A	0.940	0.96
161_W	165_Y	0.928	0.96
80_L	181_L	0.919	0.96
47_I	115_V	0.913	0.95
17_F	173_I	0.912	0.95
18_A	170_G	0.911	0.95
90_M	93_F	0.908	0.95
44_G	149_W	0.901	0.95
44_G	55_P	0.884	0.94
44_G	145_M	0.880	0.94
30_M	124_L	0.879	0.94
43_I	103_P	0.866	0.94
98_E	101_M	0.864	0.94
138_T	142_L	0.861	0.94
32_M	158_V	0.857	0.94
30_M	107_G	0.853	0.93
118_D	122_V	0.847	0.93
29_G	32_M	0.847	0.93
29_G	44_G	0.842	0.93
21_M	148_T	0.837	0.93
26_V	74_V	0.837	0.93
104_A	107_G	0.836	0.93
105_G	108_L	0.832	0.93
82_F	178_G	0.825	0.92
16_A	20_G	0.815	0.92
149_W	153_L	0.813	0.92
78_G	82_F	0.806	0.91
60_A	134_L	0.794	0.91
138_T	180_K	0.792	0.91
18_A	148_T	0.784	0.90
20_G	23_A	0.780	0.90
77_G	81_L	0.778	0.90
76_I	110_L	0.778	0.90
30_M	103_P	0.765	0.89
135_L	139_L	0.762	0.89
54_M	58_G	0.762	0.89
58_G	181_L	0.738	0.87
79_A	100_F	0.731	0.87
132_H	136_T	0.731	0.87
31_G	151_G	0.725	0.86
50_F	120_F	0.716	0.86
41_F	49_L	0.715	0.86
107_G	114_G	0.715	0.86
29_G	144_S	0.709	0.85
44_G	118_D	0.706	0.85
88_M	170_G	0.705	0.85
21_M	25_S	0.703	0.85
40_I	103_P	0.700	0.84
50_F	55_P	0.699	0.84
51_H	58_G	0.695	0.84
75_Y	89_L	0.690	0.83
52_V	133_P	0.688	0.83
34_K	100_F	0.688	0.83
46_I	109_L	0.687	0.83
104_A	139_L	0.687	0.83
48_G	144_S	0.685	0.83
69_L	76_I	0.685	0.83
115_V	119_S	0.674	0.82
134_L	138_T	0.673	0.82
86_V	93_F	0.669	0.82
79_A	138_T	0.668	0.81
114_G	177_F	0.666	0.81
54_M	140_F	0.660	0.81
10_I	14_I	0.655	0.80
14_I	177_F	0.654	0.80
23_A	119_S	0.654	0.80
110_L	173_I	0.653	0.80
103_P	107_G	0.652	0.80
39_Q	107_G	0.650	0.80
23_A	118_D	0.649	0.80
144_S	181_L	0.648	0.79
36_R	172_I	0.646	0.79
73_A	81_L	0.645	0.79
106_P	109_L	0.640	0.79
80_L	162_L	0.637	0.78
130_G	138_T	0.635	0.78
84_L	136_T	0.634	0.78
41_F	149_W	0.622	0.77
13_S	76_I	0.621	0.77
19_L	23_A	0.620	0.76
97_E	101_M	0.615	0.76
51_H	180_K	0.614	0.76
166_S	173_I	0.611	0.75
170_G	178_G	0.610	0.75
78_G	178_G	0.609	0.75
40_I	149_W	0.607	0.75
125_S	128_I	0.604	0.75
73_A	182_L	0.604	0.75
92_S	98_E	0.603	0.74
36_R	43_I	0.601	0.74
57_A	97_E	0.600	0.74
54_M	113_I	0.599	0.74
37_K	149_W	0.595	0.73
60_A	142_L	0.595	0.73
39_Q	49_L	0.592	0.73
51_H	111_F	0.589	0.73
96_S	100_F	0.588	0.73
117_L	121_S	0.586	0.72
10_I	135_L	0.586	0.72
27_G	152_L	0.581	0.72
175_I	179_L	0.579	0.71
47_I	111_F	0.575	0.71
60_A	83_V	0.573	0.71
101_M	176_V	0.573	0.71
80_L	88_M	0.573	0.71
162_L	165_Y	0.573	0.71
47_I	148_T	0.571	0.70
20_G	51_H	0.570	0.70
174_L	178_G	0.570	0.70
95_Q	99_R	0.568	0.70
42_Y	150_L	0.567	0.70
120_F	124_L	0.566	0.70
55_P	167_E	0.564	0.69
62_G	163_G	0.564	0.69
48_G	113_I	0.564	0.69
89_L	92_S	0.557	0.68
78_G	115_V	0.554	0.68
88_M	159_Q	0.552	0.68
97_E	100_F	0.551	0.68
25_S	84_L	0.544	0.67
28_L	43_I	0.544	0.67
16_A	26_V	0.543	0.67
99_R	169_L	0.540	0.66
40_I	45_F	0.538	0.66
51_H	170_G	0.536	0.66
41_F	60_A	0.536	0.66
124_L	133_P	0.536	0.66
67_G	142_L	0.534	0.65
16_A	148_T	0.534	0.65
136_T	140_F	0.533	0.65
104_A	111_F	0.533	0.65
44_G	48_G	0.532	0.65
25_S	165_Y	0.530	0.65
119_S	170_G	0.530	0.65
30_M	33_V	0.530	0.65
63_N	127_G	0.530	0.65
58_G	141_G	0.529	0.65
77_G	87_Q	0.528	0.64
51_H	143_F	0.527	0.64
26_V	84_L	0.526	0.64
57_A	150_L	0.526	0.64
89_L	105_G	0.525	0.64
93_F	168_A	0.525	0.64
50_F	122_V	0.524	0.64
16_A	147_L	0.522	0.64
31_G	111_F	0.521	0.63
23_A	170_G	0.521	0.63
49_L	159_Q	0.519	0.63
10_I	86_V	0.517	0.63
54_M	115_V	0.516	0.63
156_K	169_L	0.516	0.63
13_S	20_G	0.515	0.62
83_V	102_S	0.514	0.62
30_M	127_G	0.512	0.62
97_E	146_M	0.508	0.61
14_I	84_L	0.508	0.61
78_G	170_G	0.507	0.61
36_R	138_T	0.505	0.61
90_M	97_E	0.502	0.61
17_F	67_G	0.502	0.61
112_A	137_I	0.500	0.60
87_Q	115_V	0.500	0.60

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3j1zP	8	0.5135	18.4	0.934	Contact Map
4p6vD	1	0.7784	16.3	0.936	Contact Map
1pw4A	1	0.9514	11.9	0.94	Contact Map
3wdoA	1	0.4757	10.6	0.941	Contact Map
4bemJ	1	0.7243	7.9	0.944	Contact Map
4w6vA	1	0.5027	7.9	0.944	Contact Map
2wswA	3	0.4973	7	0.946	Contact Map
4n7wA	2	0.8054	6.9	0.946	Contact Map
4xnjA	1	0.4703	6.7	0.946	Contact Map
4pypA	1	0.4324	5.9	0.948	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0067 seconds.