YWLB - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YWLB - Uncharacterized protein YwlB

UniProt:	P39152	Sequences: MFYQLRVAREKDGDVLEAFLKQAKTSYEGVKEGFTQFLMLEDSEKNIAGCLGIEKISCDQGLLRSLVISDKLHQGHIVTLFQSMEVLCEKHQIKTVYLVANQHSSADFLTAMGFERAESVPEELFSSDHFCESRQTEGAVLMKKASG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	147 (133)
Sequences:	324 (278)
Seq/√Len:	24.1

BACSU - YWLB

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
85_E	114_F	6.650	1.00
23_A	67_V	4.503	1.00
51_L	84_M	4.452	1.00
51_L	66_L	3.475	1.00
85_E	96_V	2.923	1.00
61_G	93_I	2.769	0.99
6_R	41_E	2.698	0.99
124_L	127_S	2.402	0.98
29_G	133_S	2.356	0.98
97_Y	141_L	2.063	0.95
66_L	81_F	1.812	0.91
122_E	126_S	1.688	0.87
6_R	12_D	1.634	0.86
72_L	77_I	1.628	0.85
120_V	141_L	1.619	0.85
49_G	55_K	1.607	0.85
29_G	124_L	1.595	0.84
19_F	69_S	1.578	0.83
99_V	130_F	1.574	0.83
125_F	130_F	1.573	0.83
37_F	52_G	1.568	0.83
100_A	109_L	1.561	0.83
134_R	139_A	1.547	0.82
134_R	137_E	1.482	0.79
20_L	26_S	1.478	0.79
81_F	112_M	1.443	0.77
8_A	39_M	1.384	0.74
96_V	100_A	1.375	0.74
16_L	19_F	1.356	0.73
60_Q	123_E	1.344	0.72
96_V	114_F	1.334	0.72
8_A	50_C	1.317	0.71
25_T	54_E	1.317	0.71
62_L	124_L	1.286	0.69
99_V	109_L	1.281	0.68
78_V	112_M	1.272	0.68
104_S	129_H	1.241	0.66
29_G	114_F	1.232	0.65
8_A	16_L	1.187	0.62
50_C	108_F	1.186	0.62
104_S	135_Q	1.172	0.61
39_M	47_I	1.161	0.61
68_I	73_H	1.152	0.60
81_F	108_F	1.144	0.59
85_E	112_M	1.140	0.59
120_V	130_F	1.135	0.59
26_S	29_G	1.115	0.57
114_F	125_F	1.108	0.57
63_L	96_V	1.105	0.57
16_L	50_C	1.103	0.57
64_R	98_L	1.091	0.56
26_S	134_R	1.091	0.56
19_F	50_C	1.090	0.56
92_Q	95_T	1.066	0.54
37_F	118_E	1.063	0.54
40_L	49_G	1.062	0.54
51_L	99_V	1.059	0.53
26_S	73_H	1.050	0.53
55_K	61_G	1.048	0.53
108_F	111_A	1.047	0.53
55_K	124_L	1.039	0.52
16_L	61_G	1.036	0.52
24_K	128_D	1.031	0.51
50_C	67_V	1.028	0.51
20_L	65_S	0.996	0.49
16_L	39_M	0.980	0.48
16_L	33_G	0.978	0.48
82_Q	117_A	0.971	0.47
11_K	32_E	0.968	0.47
42_D	77_I	0.967	0.47
117_A	129_H	0.961	0.46
22_Q	42_D	0.960	0.46
97_Y	124_L	0.960	0.46
73_H	92_Q	0.937	0.45
98_L	142_M	0.927	0.44
99_V	120_V	0.925	0.44
20_L	136_T	0.922	0.44
101_N	105_S	0.920	0.44
18_A	39_M	0.912	0.43
73_H	76_H	0.911	0.43
67_V	81_F	0.903	0.42
104_S	137_E	0.888	0.41
105_S	135_Q	0.882	0.41
26_S	99_V	0.878	0.41
56_I	127_S	0.877	0.41
24_K	88_C	0.870	0.40
25_T	105_S	0.867	0.40
61_G	96_V	0.866	0.40
44_E	60_Q	0.864	0.40
21_K	75_G	0.864	0.40
53_I	77_I	0.860	0.39
53_I	107_D	0.860	0.39
15_V	92_Q	0.856	0.39
135_Q	139_A	0.850	0.39
18_A	42_D	0.844	0.38
10_E	82_Q	0.841	0.38
109_L	121_P	0.839	0.38
97_Y	126_S	0.837	0.38
62_L	129_H	0.824	0.37
88_C	133_S	0.805	0.36
17_E	95_T	0.802	0.36
56_I	61_G	0.791	0.35
25_T	135_Q	0.788	0.35
39_M	141_L	0.784	0.34
68_I	108_F	0.774	0.34
16_L	34_F	0.765	0.33
20_L	73_H	0.761	0.33
16_L	40_L	0.761	0.33
20_L	25_T	0.757	0.33
21_K	119_S	0.756	0.33
129_H	134_R	0.752	0.32
40_L	84_M	0.744	0.32
23_A	78_V	0.734	0.31
72_L	89_E	0.732	0.31
12_D	16_L	0.722	0.31
97_Y	143_K	0.719	0.30
42_D	82_Q	0.718	0.30
67_V	108_F	0.716	0.30
38_L	50_C	0.716	0.30
78_V	81_F	0.715	0.30
28_E	122_E	0.714	0.30
109_L	130_F	0.711	0.30
26_S	139_A	0.710	0.30
16_L	35_T	0.707	0.30
23_A	50_C	0.703	0.29
23_A	41_E	0.701	0.29
69_S	132_E	0.698	0.29
100_A	134_R	0.697	0.29
66_L	88_C	0.686	0.28
25_T	98_L	0.679	0.28
50_C	97_Y	0.675	0.28
20_L	127_S	0.674	0.28
120_V	124_L	0.666	0.27
80_L	142_M	0.664	0.27
40_L	111_A	0.660	0.27
87_L	101_N	0.659	0.27
85_E	130_F	0.657	0.27
25_T	113_G	0.656	0.27
68_I	80_L	0.655	0.27
26_S	101_N	0.654	0.27
79_T	86_V	0.653	0.27
63_L	85_E	0.653	0.27
40_L	141_L	0.652	0.26
127_S	137_E	0.652	0.26
95_T	141_L	0.651	0.26
14_D	22_Q	0.651	0.26
20_L	105_S	0.649	0.26
21_K	142_M	0.645	0.26
53_I	71_K	0.643	0.26
49_G	124_L	0.641	0.26
40_L	51_L	0.640	0.26
66_L	80_L	0.639	0.26
16_L	21_K	0.632	0.25
49_G	106_A	0.632	0.25
42_D	94_K	0.631	0.25
44_E	123_E	0.629	0.25
100_A	121_P	0.623	0.25
126_S	129_H	0.620	0.25
104_S	134_R	0.615	0.24
8_A	40_L	0.615	0.24
95_T	117_A	0.614	0.24
53_I	62_L	0.609	0.24
65_S	98_L	0.604	0.24
48_A	77_I	0.603	0.24
57_S	122_E	0.600	0.24
51_L	67_V	0.592	0.23
31_K	117_A	0.592	0.23
18_A	22_Q	0.586	0.23
100_A	135_Q	0.586	0.23
71_K	107_D	0.584	0.23
38_L	84_M	0.584	0.23
105_S	134_R	0.581	0.23
45_K	86_V	0.580	0.23
50_C	88_C	0.575	0.22
98_L	105_S	0.573	0.22
25_T	73_H	0.573	0.22
15_V	117_A	0.571	0.22
90_K	94_K	0.569	0.22
23_A	81_F	0.567	0.22
18_A	119_S	0.567	0.22
12_D	32_E	0.564	0.22
56_I	124_L	0.564	0.22
26_S	135_Q	0.558	0.22
26_S	100_A	0.554	0.21
17_E	31_K	0.553	0.21
31_K	36_Q	0.552	0.21
48_A	72_L	0.548	0.21
36_Q	91_H	0.537	0.21
33_G	123_E	0.528	0.20
129_H	139_A	0.528	0.20
11_K	30_V	0.527	0.20
36_Q	93_I	0.519	0.20
37_F	74_Q	0.516	0.20
8_A	30_V	0.514	0.20
49_G	109_L	0.510	0.19
110_T	142_M	0.509	0.19
95_T	120_V	0.508	0.19
50_C	123_E	0.501	0.19
109_L	124_L	0.501	0.19
70_D	75_G	0.500	0.19

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3e0kA	2	0.9252	99.6	0.661	Contact Map
3d2mA	5	0.9524	99.5	0.672	Contact Map
1y9kA	1	0.9796	99.5	0.673	Contact Map
3te4A	1	0.9864	99.5	0.676	Contact Map
2g3aA	2	0.8912	99.5	0.678	Contact Map
3fixA	2	0.8707	99.5	0.68	Contact Map
3gy9A	3	0.8639	99.5	0.681	Contact Map
2j8mA	2	0.9524	99.5	0.682	Contact Map
3d8pA	1	0.9524	99.5	0.683	Contact Map
2r7hA	2	0.9184	99.5	0.683	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0062 seconds.