COMFB - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

COMFB - ComF operon protein 2

UniProt:	P39146	Sequences: MLVNSKEIVMKELLDRYMDQLHMACTCQVCQNDVLALSLNKVSPSYVTDFKKIAYTKAELVDKQKNTAMLVILAESAAVVSESPSDLCQTKQEEAFIN	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	98 (86)
Sequences:	160 (136)
Seq/√Len:	14.6

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
15_D	31_Q	4.550	1.00
11_K	35_L	3.930	1.00
2_L	32_N	3.094	0.98
22_H	26_T	3.058	0.98
64_Q	68_A	2.647	0.95
9_V	69_M	2.630	0.95
21_L	77_A	2.426	0.92
14_L	81_S	2.398	0.92
61_V	65_K	2.196	0.88
52_K	86_D	2.124	0.86
61_V	68_A	1.801	0.74
70_L	73_L	1.768	0.73
65_K	68_A	1.735	0.72
6_K	64_Q	1.726	0.71
42_V	49_D	1.716	0.71
59_E	79_V	1.678	0.69
31_Q	35_L	1.599	0.65
5_S	47_V	1.524	0.61
34_V	49_D	1.458	0.58
34_V	54_A	1.439	0.57
37_L	79_V	1.430	0.56
27_C	84_P	1.418	0.56
2_L	51_K	1.345	0.51
37_L	41_K	1.308	0.49
56_T	81_S	1.287	0.48
28_Q	31_Q	1.264	0.47
23_M	72_I	1.239	0.46
55_Y	73_L	1.235	0.45
2_L	35_L	1.212	0.44
20_Q	41_K	1.208	0.44
51_K	75_E	1.130	0.40
16_R	70_L	1.043	0.35
14_L	35_L	1.035	0.35
43_S	71_V	1.028	0.34
49_D	86_D	1.026	0.34
12_E	76_S	1.007	0.33
70_L	85_S	1.001	0.33
45_S	53_I	0.991	0.33
10_M	35_L	0.988	0.32
15_D	24_A	0.986	0.32
55_Y	64_Q	0.981	0.32
15_D	35_L	0.962	0.31
6_K	42_V	0.942	0.30
20_Q	77_A	0.928	0.30
50_F	78_A	0.927	0.30
3_V	73_L	0.924	0.29
67_T	74_A	0.907	0.29
37_L	74_A	0.898	0.28
67_T	85_S	0.894	0.28
29_V	75_E	0.891	0.28
70_L	74_A	0.884	0.28
32_N	47_V	0.858	0.27
2_L	50_F	0.851	0.26
72_I	86_D	0.850	0.26
67_T	72_I	0.838	0.26
67_T	73_L	0.831	0.25
70_L	77_A	0.820	0.25
58_A	71_V	0.819	0.25
42_V	52_K	0.810	0.24
13_L	58_A	0.808	0.24
68_A	76_S	0.790	0.24
38_S	78_A	0.785	0.23
26_T	83_S	0.779	0.23
16_R	54_A	0.779	0.23
47_V	71_V	0.767	0.23
72_I	75_E	0.764	0.23
24_A	43_S	0.747	0.22
41_K	72_I	0.741	0.22
79_V	82_E	0.739	0.22
22_H	58_A	0.738	0.22
10_M	52_K	0.722	0.21
27_C	36_A	0.697	0.20
51_K	74_A	0.696	0.20
11_K	31_Q	0.689	0.20
62_D	87_L	0.684	0.20
3_V	14_L	0.684	0.20
55_Y	60_L	0.682	0.20
34_V	73_L	0.681	0.20
3_V	21_L	0.679	0.20
28_Q	75_E	0.676	0.19
10_M	86_D	0.674	0.19
55_Y	71_V	0.664	0.19
48_T	76_S	0.662	0.19
45_S	59_E	0.656	0.19
49_D	65_K	0.655	0.19
9_V	62_D	0.650	0.19
38_S	76_S	0.648	0.18
8_I	72_I	0.647	0.18
6_K	61_V	0.646	0.18
32_N	54_A	0.637	0.18
82_E	86_D	0.635	0.18
36_A	48_T	0.630	0.18
8_I	58_A	0.623	0.18
60_L	74_A	0.611	0.17
6_K	65_K	0.603	0.17
29_V	76_S	0.601	0.17
3_V	78_A	0.601	0.17
29_V	48_T	0.600	0.17
21_L	55_Y	0.596	0.17
6_K	28_Q	0.594	0.17
21_L	34_V	0.591	0.17
11_K	15_D	0.590	0.17
57_K	68_A	0.579	0.16
32_N	66_N	0.576	0.16
41_K	56_T	0.574	0.16
13_L	28_Q	0.573	0.16
14_L	45_S	0.569	0.16
11_K	60_L	0.568	0.16
23_M	54_A	0.565	0.16
53_I	63_K	0.555	0.16
42_V	63_K	0.547	0.15
19_D	74_A	0.547	0.15
49_D	52_K	0.538	0.15
3_V	53_I	0.528	0.15
18_M	34_V	0.526	0.15
62_D	83_S	0.524	0.15
34_V	77_A	0.522	0.15
15_D	79_V	0.517	0.14
24_A	67_T	0.516	0.14
22_H	67_T	0.516	0.14
47_V	80_V	0.514	0.14
16_R	32_N	0.507	0.14
47_V	84_P	0.503	0.14
7_E	30_C	0.500	0.14
7_E	33_D	0.500	0.14
30_C	33_D	0.500	0.14
30_C	46_Y	0.500	0.14
33_D	46_Y	0.500	0.14
7_E	46_Y	0.500	0.14

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4waiA	2	0.9184	100	0.254	Contact Map
4mfuA	2	0.8776	15.2	0.929	Contact Map
4cb9A	1	0.8776	13.1	0.931	Contact Map
4bkwA	1	0.3367	11.3	0.933	Contact Map
4fakA	2	0.8878	7.7	0.938	Contact Map
1ns5A	2	0.898	5.8	0.941	Contact Map
1to0A	2	0.8673	5.6	0.942	Contact Map
3qwpA	1	0.9796	5.3	0.942	Contact Map
4ouaA	1	0.5612	4.3	0.945	Contact Map
3l3uA	2	0.8673	4.1	0.945	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0051 seconds.