SFP - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

SFP - 4'-phosphopantetheinyl transferase sfp

UniProt:	P39135	Sequences: MKIYGIYMDRPLSQEENERFMSFISPEKREKCRRFYHKEDAHRTLLGDVLVRSVISRQYQLDKSDIRFSTQEYGKPCIPDLPDAHFNISHSGRWVICAFDSQPIGIDIEKTKPISLEIAKRFFSKTEYSDLLAKDKDEQTDYFYHLWSMKESFIKQEGKGLSLPLDSFSVRLHQDGQVSIELPDSHSPCYIKTYEVDPGYKMAVCAAHPDFPEDITMVSYEELL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	224 (195)
Sequences:	1977 (1686)
Seq/√Len:	120.7

ECOLI - YIEE ACPT
BACSU - SFP

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
85_H	103_P	3.213	1.00
37_H	40_D	3.005	1.00
96_I	202_M	2.894	1.00
124_S	169_S	2.848	1.00
98_A	104_I	2.825	1.00
28_K	48_D	2.764	1.00
96_I	106_I	2.727	1.00
156_Q	189_C	2.655	1.00
75_K	85_H	2.552	1.00
69_S	77_C	2.546	1.00
149_M	193_T	2.400	1.00
127_E	150_K	2.247	1.00
149_M	170_V	2.221	1.00
154_I	165_L	2.214	1.00
55_I	86_F	2.174	1.00
32_C	45_L	2.128	1.00
35_F	40_D	2.121	1.00
109_E	148_S	2.077	1.00
149_M	191_I	2.073	1.00
152_S	205_C	2.046	1.00
91_S	109_E	2.031	1.00
40_D	43_R	2.014	1.00
148_S	203_A	1.986	1.00
54_V	97_C	1.951	1.00
54_V	99_F	1.934	1.00
32_C	44_T	1.854	1.00
154_I	159_K	1.833	1.00
44_T	48_D	1.830	1.00
21_M	33_R	1.827	1.00
194_Y	202_M	1.823	1.00
145_H	193_T	1.737	1.00
126_T	169_S	1.724	1.00
98_A	106_I	1.690	1.00
75_K	103_P	1.688	1.00
98_A	204_V	1.664	1.00
69_S	79_P	1.646	1.00
89_S	96_I	1.633	1.00
131_L	134_K	1.571	1.00
56_S	66_I	1.571	1.00
119_A	128_Y	1.555	1.00
50_L	95_V	1.533	1.00
140_T	144_Y	1.515	1.00
39_E	43_R	1.508	1.00
119_A	122_F	1.499	1.00
43_R	93_R	1.498	1.00
136_K	139_Q	1.485	1.00
130_D	142_Y	1.479	1.00
130_D	146_L	1.471	1.00
28_K	44_T	1.450	1.00
31_K	44_T	1.446	1.00
59_Y	66_I	1.433	1.00
154_I	163_L	1.432	1.00
92_G	110_K	1.414	1.00
134_K	142_Y	1.409	1.00
47_G	95_V	1.371	1.00
159_K	163_L	1.341	1.00
24_I	28_K	1.335	1.00
48_D	88_I	1.332	1.00
30_E	34_R	1.328	1.00
154_I	161_L	1.318	1.00
149_M	203_A	1.315	1.00
47_G	88_I	1.305	1.00
94_W	108_I	1.304	1.00
46_L	95_V	1.302	1.00
111_T	144_Y	1.280	1.00
56_S	63_K	1.277	1.00
36_Y	40_D	1.259	0.99
170_V	191_I	1.257	0.99
112_K	144_Y	1.249	0.99
100_D	104_I	1.227	0.99
71_Q	77_C	1.219	0.99
138_E	141_D	1.201	0.99
38_K	41_A	1.190	0.99
88_I	97_C	1.184	0.99
66_I	78_I	1.164	0.99
193_T	203_A	1.163	0.99
25_S	52_R	1.157	0.99
28_K	52_R	1.141	0.99
32_C	35_F	1.137	0.99
31_K	70_T	1.136	0.99
154_I	168_F	1.136	0.99
161_L	165_L	1.132	0.99
29_R	33_R	1.130	0.99
24_I	44_T	1.127	0.99
153_F	157_E	1.123	0.99
120_K	128_Y	1.114	0.99
51_V	88_I	1.102	0.99
56_S	59_Y	1.101	0.99
51_V	97_C	1.076	0.98
52_R	63_K	1.065	0.98
103_P	207_A	1.061	0.98
26_P	30_E	1.059	0.98
164_P	167_S	1.035	0.98
59_Y	78_I	1.030	0.98
197_D	200_Y	1.029	0.98
61_L	66_I	1.026	0.98
125_K	129_S	1.010	0.98
153_F	205_C	1.008	0.98
142_Y	145_H	1.006	0.98
48_D	52_R	0.999	0.97
67_R	79_P	0.998	0.97
58_Q	84_A	0.988	0.97
52_R	56_S	0.987	0.97
142_Y	146_L	0.981	0.97
26_P	29_R	0.975	0.97
50_L	97_C	0.961	0.97
21_M	29_R	0.952	0.97
90_H	108_I	0.952	0.97
40_D	95_V	0.950	0.96
38_K	42_H	0.940	0.96
85_H	100_D	0.939	0.96
93_R	200_Y	0.928	0.96
73_Y	162_S	0.925	0.96
62_D	65_D	0.921	0.96
52_R	66_I	0.917	0.96
82_P	106_I	0.901	0.95
91_S	110_K	0.899	0.95
118_I	154_I	0.890	0.95
145_H	201_K	0.888	0.95
39_E	92_G	0.885	0.95
13_S	16_E	0.880	0.95
53_S	57_R	0.875	0.94
86_F	97_C	0.865	0.94
19_R	22_S	0.858	0.94
144_Y	201_K	0.854	0.94
75_K	87_N	0.851	0.94
154_I	160_G	0.851	0.94
116_L	119_A	0.849	0.94
89_S	108_I	0.844	0.93
134_K	138_E	0.843	0.93
163_L	167_S	0.841	0.93
75_K	86_F	0.839	0.93
16_E	19_R	0.836	0.93
91_S	148_S	0.834	0.93
16_E	20_F	0.827	0.93
86_F	143_F	0.826	0.93
164_P	168_F	0.825	0.93
111_T	201_K	0.818	0.92
109_E	119_A	0.810	0.92
118_I	122_F	0.807	0.92
54_V	58_Q	0.805	0.92
58_Q	189_C	0.804	0.92
43_R	92_G	0.801	0.91
148_S	193_T	0.801	0.91
62_D	114_I	0.800	0.91
28_K	56_S	0.800	0.91
58_Q	99_F	0.795	0.91
23_F	53_S	0.793	0.91
48_D	70_T	0.792	0.91
161_L	164_P	0.791	0.91
75_K	158_G	0.791	0.91
123_F	168_F	0.788	0.91
43_R	91_S	0.785	0.91
102_Q	207_A	0.782	0.90
141_D	201_K	0.780	0.90
129_S	133_A	0.775	0.90
118_I	143_F	0.773	0.90
194_Y	197_D	0.759	0.89
157_E	163_L	0.755	0.89
163_L	168_F	0.746	0.88
123_F	128_Y	0.745	0.88
25_S	28_K	0.739	0.88
24_I	48_D	0.734	0.87
94_W	197_D	0.734	0.87
123_F	165_L	0.733	0.87
52_R	68_F	0.732	0.87
167_S	182_L	0.727	0.87
113_P	140_T	0.727	0.87
51_V	78_I	0.725	0.87
79_P	82_P	0.723	0.87
149_M	153_F	0.723	0.87
25_S	48_D	0.722	0.87
131_L	146_L	0.721	0.86
51_V	95_V	0.716	0.86
116_L	139_Q	0.715	0.86
91_S	200_Y	0.712	0.86
47_G	51_V	0.710	0.86
110_K	199_G	0.709	0.86
35_F	44_T	0.708	0.85
51_V	109_E	0.707	0.85
135_D	138_E	0.704	0.85
48_D	152_S	0.701	0.85
120_K	132_L	0.701	0.85
26_P	133_A	0.698	0.85
196_V	202_M	0.696	0.84
171_R	174_Q	0.694	0.84
22_S	64_S	0.692	0.84
191_I	205_C	0.689	0.84
50_L	96_I	0.688	0.84
48_D	51_V	0.684	0.83
153_F	156_Q	0.683	0.83
149_M	202_M	0.683	0.83
122_F	165_L	0.682	0.83
92_G	200_Y	0.682	0.83
146_L	170_V	0.680	0.83
114_I	140_T	0.680	0.83
131_L	142_Y	0.676	0.83
30_E	33_R	0.673	0.82
117_E	121_R	0.672	0.82
51_V	86_F	0.666	0.82
109_E	112_K	0.662	0.81
71_Q	87_N	0.661	0.81
128_Y	132_L	0.659	0.81
87_N	154_I	0.654	0.81
194_Y	204_V	0.646	0.80
107_D	151_E	0.642	0.79
141_D	195_E	0.640	0.79
108_I	200_Y	0.636	0.79
48_D	156_Q	0.636	0.79
29_R	37_H	0.635	0.79
17_N	22_S	0.631	0.78
28_K	31_K	0.629	0.78
189_C	205_C	0.629	0.78
55_I	63_K	0.628	0.78
51_V	55_I	0.628	0.78
21_M	32_C	0.627	0.78
24_I	41_A	0.625	0.78
189_C	207_A	0.623	0.77
20_F	23_F	0.621	0.77
61_L	65_D	0.621	0.77
190_Y	194_Y	0.620	0.77
124_S	150_K	0.619	0.77
50_L	53_S	0.615	0.76
28_K	152_S	0.615	0.76
149_M	171_R	0.614	0.76
153_F	189_C	0.611	0.76
17_N	24_I	0.607	0.76
104_I	111_T	0.605	0.75
51_V	99_F	0.600	0.75
183_P	186_H	0.600	0.75
118_I	121_R	0.599	0.75
17_N	41_A	0.599	0.75
18_E	21_M	0.596	0.74
119_A	131_L	0.595	0.74
122_F	128_Y	0.593	0.74
51_V	68_F	0.591	0.74
87_N	97_C	0.591	0.74
44_T	47_G	0.588	0.73
32_C	52_R	0.588	0.73
15_E	19_R	0.587	0.73
40_D	44_T	0.585	0.73
116_L	131_L	0.585	0.73
122_F	168_F	0.581	0.72
44_T	88_I	0.576	0.72
100_D	206_A	0.573	0.71
40_D	92_G	0.572	0.71
177_Q	181_E	0.570	0.71
112_K	133_A	0.564	0.70
52_R	55_I	0.564	0.70
190_Y	206_A	0.558	0.69
13_S	129_S	0.554	0.69
146_L	149_M	0.552	0.68
32_C	184_D	0.552	0.68
40_D	114_I	0.550	0.68
154_I	162_S	0.549	0.68
31_K	45_L	0.547	0.68
188_P	204_V	0.544	0.67
153_F	191_I	0.544	0.67
105_G	155_K	0.543	0.67
91_S	144_Y	0.543	0.67
128_Y	131_L	0.543	0.67
33_R	41_A	0.541	0.67
51_V	91_S	0.540	0.67
123_F	143_F	0.540	0.67
188_P	207_A	0.540	0.67
24_I	63_K	0.539	0.67
105_G	151_E	0.538	0.67
77_C	99_F	0.538	0.67
145_H	149_M	0.536	0.66
172_L	178_V	0.536	0.66
116_L	152_S	0.535	0.66
23_F	28_K	0.534	0.66
118_I	123_F	0.533	0.66
28_K	156_Q	0.532	0.66
25_S	68_F	0.530	0.65
51_V	70_T	0.529	0.65
31_K	41_A	0.529	0.65
54_V	88_I	0.528	0.65
125_K	166_D	0.526	0.65
153_F	160_G	0.520	0.64
183_P	187_S	0.517	0.63
22_S	29_R	0.516	0.63
50_L	89_S	0.516	0.63
84_A	153_F	0.514	0.63
156_Q	205_C	0.513	0.63
87_N	158_G	0.509	0.62
124_S	131_L	0.507	0.62
34_R	70_T	0.504	0.62
87_N	144_Y	0.503	0.61
14_Q	20_F	0.502	0.61
53_S	60_Q	0.501	0.61
122_F	166_D	0.500	0.61

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1qr0A	2	1	100	0.175	Contact Map
2c43A	1	0.9866	100	0.254	Contact Map
4qjkA	1	0.8929	100	0.457	Contact Map
4qvhA	2	0.875	100	0.457	Contact Map
4jm7A	3	0.5491	99.9	0.588	Contact Map
3hykA	3	0.5	99.7	0.676	Contact Map
2wasA	3	0.4732	99.7	0.685	Contact Map
1fthA	3	0.4911	99.7	0.687	Contact Map
1f7lA	3	0.4866	99.6	0.694	Contact Map
2wdsA	3	0.4821	99.6	0.694	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0073 seconds.