DEOC - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DEOC - Deoxyribose-phosphate aldolase

UniProt:	P39121	Sequences: MSLANIIDHTALKPHTQKADILKLIEEAKTYKFASVCVNPTWVELAAKELKGTGVDVCTVIGFPLGANTTETKAFETKDAISKGATEVDMVINIAALKDKEDDVVEADIRGVVEAVAGKALVKVIIETCLLTDEEKERACRLAVSAGADFVKTSTGFSTGGATKEDIALMRKTVGPDIGVKASGGVRTKEDVDTMVEAGASRIGASAGVSIVKGENASGGDNY	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	223 (209)
Sequences:	3229 (2108)
Seq/√Len:	145.8

ECOLI - DEOC
BACSU - DEOC
HALSA - DEOC

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
188_T	191_D	3.614	1.00
106_E	145_S	2.935	1.00
98_K	135_E	2.868	1.00
79_D	83_K	2.837	1.00
101_E	104_V	2.796	1.00
113_V	122_V	2.725	1.00
102_D	138_R	2.711	1.00
144_V	178_I	2.564	1.00
179_G	201_S	2.517	1.00
6_I	196_V	2.382	1.00
136_K	166_D	2.344	1.00
106_E	110_R	2.270	1.00
97_L	102_D	2.212	1.00
130_L	158_S	2.193	1.00
22_L	45_L	2.153	1.00
96_A	104_V	2.130	1.00
96_A	101_E	2.119	1.00
35_S	58_C	2.024	1.00
168_A	172_K	1.986	1.00
70_T	74_A	1.897	1.00
90_M	109_I	1.865	1.00
11_A	16_T	1.860	1.00
22_L	49_E	1.835	1.00
138_R	141_R	1.829	1.00
56_D	86_T	1.793	1.00
164_K	194_T	1.785	1.00
92_I	97_L	1.776	1.00
11_A	21_I	1.714	1.00
137_E	173_T	1.707	1.00
133_D	165_E	1.698	1.00
26_E	30_T	1.694	1.00
69_T	79_D	1.667	1.00
189_K	193_D	1.653	1.00
78_K	82_S	1.608	1.00
77_T	116_V	1.587	1.00
192_V	203_I	1.583	1.00
110_R	114_E	1.576	1.00
144_V	175_G	1.575	1.00
193_D	197_E	1.551	1.00
108_D	112_V	1.539	1.00
34_A	56_D	1.487	1.00
26_E	49_E	1.483	1.00
44_E	83_K	1.464	1.00
129_C	158_S	1.460	1.00
39_N	65_L	1.455	1.00
124_V	148_A	1.434	1.00
72_T	75_F	1.432	1.00
77_T	88_V	1.421	1.00
71_E	79_D	1.418	1.00
22_L	26_E	1.413	1.00
86_T	120_A	1.411	1.00
132_T	135_E	1.410	1.00
69_T	83_K	1.387	1.00
79_D	82_S	1.385	1.00
97_L	139_A	1.382	1.00
18_K	99_D	1.371	1.00
171_R	176_P	1.371	1.00
133_D	136_K	1.368	1.00
47_A	86_T	1.364	1.00
97_L	142_L	1.349	1.00
7_I	208_G	1.349	1.00
43_V	57_V	1.336	1.00
39_N	67_A	1.322	1.00
81_I	115_A	1.320	1.00
167_I	180_V	1.312	1.00
126_I	136_K	1.309	1.00
187_R	191_D	1.294	1.00
191_D	194_T	1.289	1.00
92_I	139_A	1.271	1.00
41_T	93_N	1.264	1.00
68_N	72_T	1.259	1.00
164_K	198_A	1.253	1.00
140_C	170_M	1.251	1.00
128_T	183_S	1.250	1.00
106_E	142_L	1.248	1.00
191_D	195_M	1.248	1.00
32_K	54_G	1.236	1.00
129_C	159_T	1.226	1.00
18_K	45_L	1.209	1.00
45_L	49_E	1.206	1.00
116_V	122_V	1.198	1.00
19_A	22_L	1.180	1.00
17_Q	20_D	1.179	1.00
18_K	42_W	1.168	1.00
40_P	68_N	1.159	1.00
140_C	174_V	1.156	1.00
137_E	172_K	1.156	1.00
33_F	208_G	1.145	0.99
187_R	207_A	1.138	0.99
190_E	194_T	1.131	0.99
174_V	180_V	1.120	0.99
144_V	177_D	1.118	0.99
40_P	59_T	1.113	0.99
209_V	212_V	1.109	0.99
11_A	20_D	1.108	0.99
160_G	163_T	1.104	0.99
46_A	57_V	1.101	0.99
68_N	76_E	1.097	0.99
20_D	23_K	1.094	0.99
43_V	59_T	1.093	0.99
126_I	151_V	1.091	0.99
29_K	53_T	1.086	0.99
35_S	56_D	1.085	0.99
171_R	179_G	1.077	0.99
70_T	108_D	1.073	0.99
107_A	111_G	1.073	0.99
9_H	208_G	1.066	0.99
61_I	88_V	1.047	0.99
81_I	120_A	1.046	0.99
4_A	32_K	1.030	0.99
113_V	116_V	1.016	0.99
5_N	32_K	1.011	0.99
128_T	166_D	1.007	0.99
25_I	36_V	0.999	0.99
137_E	141_R	0.998	0.99
121_L	149_D	0.993	0.99
18_K	22_L	0.982	0.98
190_E	193_D	0.964	0.98
113_V	149_D	0.952	0.98
111_G	114_E	0.948	0.98
107_A	110_R	0.947	0.98
18_K	101_E	0.943	0.98
93_N	108_D	0.939	0.98
171_R	201_S	0.937	0.98
31_Y	209_V	0.937	0.98
140_C	151_V	0.934	0.98
164_K	195_M	0.934	0.98
25_I	49_E	0.931	0.98
165_E	168_A	0.929	0.98
47_A	57_V	0.928	0.98
74_A	115_A	0.917	0.98
143_A	148_A	0.914	0.98
50_L	55_V	0.912	0.97
15_H	130_L	0.910	0.97
5_N	54_G	0.907	0.97
105_V	108_D	0.906	0.97
73_K	108_D	0.906	0.97
44_E	48_K	0.906	0.97
37_C	58_C	0.905	0.97
136_K	169_L	0.905	0.97
126_I	139_A	0.902	0.97
14_P	65_L	0.901	0.97
40_P	69_T	0.899	0.97
102_D	142_L	0.891	0.97
3_L	192_V	0.886	0.97
62_G	68_N	0.872	0.97
137_E	169_L	0.871	0.97
143_A	146_A	0.865	0.97
37_C	60_V	0.864	0.97
106_E	146_A	0.861	0.96
103_D	106_E	0.856	0.96
26_E	29_K	0.855	0.96
48_K	51_K	0.851	0.96
170_M	180_V	0.849	0.96
103_D	107_A	0.843	0.96
164_K	168_A	0.843	0.96
33_F	212_V	0.841	0.96
151_V	170_M	0.836	0.96
75_F	78_K	0.833	0.96
43_V	83_K	0.831	0.96
3_L	6_I	0.828	0.96
21_I	42_W	0.821	0.95
160_G	166_D	0.820	0.95
194_T	198_A	0.812	0.95
33_F	209_V	0.812	0.95
141_R	173_T	0.812	0.95
8_D	35_S	0.807	0.95
65_L	157_F	0.807	0.95
192_V	212_V	0.806	0.95
69_T	72_T	0.803	0.95
194_T	197_E	0.802	0.95
122_V	149_D	0.802	0.95
208_G	212_V	0.797	0.95
151_V	174_V	0.793	0.94
23_K	27_E	0.785	0.94
109_I	148_A	0.783	0.94
10_T	24_L	0.779	0.94
130_L	159_T	0.779	0.94
154_S	161_G	0.773	0.94
9_H	27_E	0.770	0.94
42_W	99_D	0.770	0.94
150_F	179_G	0.769	0.93
38_V	46_A	0.761	0.93
143_A	170_M	0.760	0.93
74_A	112_V	0.759	0.93
126_I	143_A	0.753	0.93
29_K	52_G	0.752	0.93
11_A	24_L	0.751	0.93
74_A	111_G	0.749	0.93
129_C	154_S	0.744	0.92
109_I	143_A	0.737	0.92
29_K	54_G	0.736	0.92
128_T	160_G	0.736	0.92
207_A	210_S	0.736	0.92
96_A	99_D	0.728	0.91
38_V	43_V	0.722	0.91
90_M	112_V	0.713	0.91
205_A	208_G	0.712	0.91
113_V	118_G	0.712	0.91
41_T	104_V	0.705	0.90
59_T	80_A	0.701	0.90
93_N	96_A	0.701	0.90
41_T	96_A	0.700	0.90
154_S	162_A	0.700	0.90
62_G	76_E	0.697	0.90
5_N	34_A	0.694	0.89
144_V	174_V	0.693	0.89
74_A	78_K	0.693	0.89
88_V	116_V	0.691	0.89
3_L	189_K	0.687	0.89
192_V	196_V	0.686	0.89
144_V	151_V	0.683	0.89
80_A	85_A	0.680	0.88
168_A	197_E	0.679	0.88
136_K	140_C	0.675	0.88
186_V	207_A	0.672	0.88
31_Y	212_V	0.667	0.87
90_M	108_D	0.666	0.87
141_R	145_S	0.665	0.87
126_I	170_M	0.663	0.87
71_E	75_F	0.660	0.87
80_A	83_K	0.657	0.87
136_K	163_T	0.657	0.87
142_L	146_A	0.652	0.86
21_I	24_L	0.651	0.86
136_K	170_M	0.649	0.86
6_I	201_S	0.648	0.86
23_K	26_E	0.647	0.86
144_V	173_T	0.639	0.85
81_I	118_G	0.637	0.85
89_D	152_K	0.636	0.85
75_F	79_D	0.635	0.85
61_I	80_A	0.634	0.85
81_I	88_V	0.631	0.84
14_P	159_T	0.631	0.84
138_R	142_L	0.630	0.84
22_L	25_I	0.629	0.84
8_D	58_C	0.628	0.84
38_V	59_T	0.628	0.84
189_K	211_I	0.627	0.84
128_T	136_K	0.626	0.84
43_V	46_A	0.625	0.84
90_M	148_A	0.623	0.84
112_V	122_V	0.618	0.83
205_A	211_I	0.614	0.83
29_K	49_E	0.610	0.82
47_A	51_K	0.607	0.82
19_A	23_K	0.605	0.82
77_T	112_V	0.603	0.82
136_K	160_G	0.603	0.82
65_L	68_N	0.602	0.82
92_I	105_V	0.600	0.81
100_K	105_V	0.593	0.81
171_R	180_V	0.592	0.81
70_T	107_A	0.591	0.80
95_A	99_D	0.585	0.80
78_K	114_E	0.585	0.80
182_A	186_V	0.582	0.79
6_I	150_F	0.582	0.79
15_H	20_D	0.578	0.79
77_T	81_I	0.576	0.79
70_T	104_V	0.575	0.79
3_L	212_V	0.575	0.79
22_L	48_K	0.573	0.78
74_A	108_D	0.569	0.78
62_G	73_K	0.563	0.77
71_E	83_K	0.560	0.77
113_V	119_K	0.560	0.77
104_V	107_A	0.559	0.77
109_I	124_V	0.559	0.77
122_V	148_A	0.558	0.77
129_C	160_G	0.557	0.76
90_M	124_V	0.556	0.76
167_I	200_A	0.555	0.76
40_P	72_T	0.551	0.76
126_I	140_C	0.551	0.76
17_Q	99_D	0.550	0.75
28_A	55_V	0.549	0.75
94_I	97_L	0.548	0.75
25_I	46_A	0.547	0.75
7_I	33_F	0.539	0.74
81_I	116_V	0.539	0.74
57_V	86_T	0.538	0.74
166_D	169_L	0.538	0.74
171_R	175_G	0.537	0.74
12_L	157_F	0.536	0.74
56_D	121_L	0.531	0.73
100_K	135_E	0.530	0.73
133_D	166_D	0.528	0.73
67_A	93_N	0.528	0.73
186_V	195_M	0.527	0.72
71_E	111_G	0.527	0.72
142_L	145_S	0.525	0.72
141_R	144_V	0.524	0.72
25_I	50_L	0.523	0.72
161_G	183_S	0.522	0.72
112_V	115_A	0.520	0.71
192_V	211_I	0.516	0.71
42_W	45_L	0.516	0.71
80_A	88_V	0.516	0.71
94_I	130_L	0.515	0.71
29_K	55_V	0.515	0.71
90_M	122_V	0.514	0.71
140_C	173_T	0.513	0.70
113_V	120_A	0.513	0.70
134_E	137_E	0.513	0.70
144_V	176_P	0.512	0.70
16_T	20_D	0.511	0.70
133_D	172_K	0.508	0.70
167_I	195_M	0.507	0.70
92_I	124_V	0.506	0.69
139_A	146_A	0.505	0.69
12_L	37_C	0.503	0.69
42_W	95_A	0.500	0.68

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2a4aA	2	0.9596	100	0.172	Contact Map
4eivA	2	0.9776	100	0.174	Contact Map
1p1xA	1	0.9731	100	0.192	Contact Map
3r12A	2	0.9821	100	0.202	Contact Map
3oa3A	2	0.9686	100	0.204	Contact Map
1vcvA	2	0.9238	100	0.214	Contact Map
3ngjA	4	0.9641	100	0.229	Contact Map
3ndoA	2	0.9686	100	0.264	Contact Map
1ub3A	3	0.9507	100	0.299	Contact Map
1n7kA	3	0.9552	100	0.351	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0076 seconds.