CLPQ - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

CLPQ - ATP-dependent protease subunit ClpQ

UniProt:	P39070	Sequences: MSSFHATTIFAVQHKGRSAMSGDGQVTFGQAVVMKHTARKVRKLFNGKVLAGFAGSVADAFTLFEKFEAKLEEYNGNLKRAAVELAKEWRSDKVLRKLEAMLIVMNQDTLLLVSGTGEVIEPDDGILAIGSGGNYALAAGRALKKHAGESMSASEIARAALETAGEICVYTNDQIILEELE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	181 (174)
Sequences:	1205 (484)
Seq/√Len:	36.7

ECOLI - HSLV
BACSU - CLPQ

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
154_S	158_R	4.264	1.00
152_S	155_E	4.165	1.00
21_S	157_A	3.929	1.00
146_H	159_A	3.824	1.00
166_E	173_D	3.568	1.00
154_S	179_E	3.504	1.00
57_V	118_E	3.354	1.00
9_I	22_G	3.264	1.00
112_L	127_L	2.926	1.00
137_L	141_R	2.734	1.00
17_R	179_E	2.580	1.00
26_V	38_A	2.447	1.00
145_K	159_A	2.367	1.00
66_K	88_E	2.236	0.99
43_K	178_E	2.080	0.99
103_I	127_L	2.072	0.99
50_L	180_L	1.999	0.98
11_A	110_L	1.998	0.98
145_K	166_E	1.976	0.98
13_Q	110_L	1.957	0.98
14_H	147_A	1.901	0.98
46_N	72_E	1.882	0.98
103_I	110_L	1.868	0.98
124_D	141_R	1.822	0.97
27_T	169_V	1.818	0.97
165_G	173_D	1.810	0.97
110_L	127_L	1.810	0.97
21_S	175_I	1.805	0.97
158_R	162_E	1.782	0.97
67_F	104_V	1.780	0.97
51_A	64_F	1.754	0.96
82_A	113_V	1.724	0.96
34_M	120_I	1.712	0.96
28_F	101_M	1.710	0.96
103_I	126_I	1.650	0.95
162_E	173_D	1.619	0.94
21_S	161_L	1.589	0.94
51_A	104_V	1.570	0.94
93_K	97_K	1.558	0.93
14_H	144_K	1.534	0.93
159_A	162_E	1.506	0.92
57_V	60_A	1.502	0.92
27_T	31_A	1.475	0.91
45_F	76_G	1.454	0.91
82_A	111_L	1.445	0.90
28_F	34_M	1.434	0.90
128_A	133_G	1.413	0.89
18_S	110_L	1.390	0.88
10_F	161_L	1.387	0.88
10_F	140_G	1.349	0.87
41_V	176_I	1.345	0.87
30_Q	169_V	1.320	0.86
36_H	123_D	1.298	0.85
48_K	106_N	1.284	0.84
17_R	152_S	1.278	0.84
101_M	120_I	1.264	0.83
18_S	105_M	1.258	0.83
37_T	123_D	1.215	0.81
142_A	163_T	1.197	0.80
70_K	88_E	1.178	0.78
114_S	120_I	1.172	0.78
31_A	170_Y	1.162	0.78
49_V	71_L	1.157	0.77
64_F	104_V	1.144	0.76
70_K	73_E	1.127	0.75
146_H	150_S	1.120	0.75
162_E	165_G	1.111	0.74
6_A	57_V	1.111	0.74
44_L	51_A	1.109	0.74
16_G	153_A	1.099	0.73
103_I	112_L	1.079	0.72
79_K	109_T	1.031	0.69
49_V	81_A	1.017	0.67
48_K	107_Q	1.010	0.67
12_V	153_A	1.003	0.66
141_R	166_E	1.002	0.66
66_K	69_A	0.991	0.65
124_D	137_L	0.990	0.65
126_I	144_K	0.980	0.65
18_S	180_L	0.978	0.64
20_M	50_L	0.976	0.64
62_T	65_E	0.971	0.64
165_G	175_I	0.963	0.63
157_A	160_A	0.955	0.63
66_K	94_V	0.934	0.61
9_I	169_V	0.929	0.60
138_A	167_I	0.916	0.59
44_L	64_F	0.912	0.59
74_Y	84_E	0.910	0.59
87_K	95_L	0.910	0.59
124_D	145_K	0.908	0.59
135_Y	138_A	0.906	0.58
73_E	123_D	0.902	0.58
91_S	94_V	0.891	0.57
67_F	82_A	0.891	0.57
77_N	123_D	0.886	0.57
134_N	169_V	0.884	0.57
15_K	153_A	0.879	0.56
147_A	150_S	0.872	0.55
12_V	19_A	0.866	0.55
13_Q	18_S	0.853	0.54
91_S	170_Y	0.850	0.54
47_G	56_S	0.845	0.53
65_E	122_P	0.843	0.53
36_H	174_Q	0.843	0.53
147_A	159_A	0.842	0.53
154_S	177_L	0.827	0.52
30_Q	170_Y	0.824	0.51
87_K	102_L	0.822	0.51
155_E	158_R	0.814	0.50
49_V	93_K	0.808	0.50
139_A	160_A	0.806	0.50
64_F	83_V	0.802	0.49
104_V	113_V	0.795	0.49
6_A	176_I	0.792	0.48
19_A	154_S	0.791	0.48
118_E	169_V	0.782	0.48
144_K	156_I	0.778	0.47
11_A	103_I	0.777	0.47
19_A	179_E	0.770	0.47
61_F	102_L	0.764	0.46
49_V	109_T	0.761	0.46
79_K	111_L	0.761	0.46
51_A	141_R	0.758	0.45
36_H	161_L	0.757	0.45
34_M	112_L	0.752	0.45
93_K	173_D	0.749	0.45
45_F	48_K	0.747	0.45
128_A	168_C	0.744	0.44
143_L	146_H	0.744	0.44
4_F	120_I	0.739	0.44
138_A	160_A	0.735	0.43
75_N	114_S	0.734	0.43
158_R	175_I	0.732	0.43
158_R	177_L	0.730	0.43
112_L	134_N	0.730	0.43
125_G	141_R	0.728	0.43
5_H	180_L	0.726	0.43
39_R	178_E	0.723	0.42
61_F	118_E	0.722	0.42
41_V	175_I	0.716	0.42
30_Q	135_Y	0.714	0.42
56_S	137_L	0.713	0.42
13_Q	125_G	0.711	0.41
92_D	96_R	0.708	0.41
144_K	147_A	0.706	0.41
74_Y	80_R	0.705	0.41
106_N	109_T	0.704	0.41
19_A	67_F	0.702	0.41
21_S	177_L	0.695	0.40
20_M	140_G	0.694	0.40
60_A	101_M	0.691	0.40
11_A	20_M	0.688	0.39
22_G	41_V	0.687	0.39
34_M	97_K	0.686	0.39
31_A	118_E	0.677	0.39
11_A	105_M	0.674	0.38
6_A	65_E	0.669	0.38
146_H	151_M	0.664	0.37
26_V	61_F	0.663	0.37
27_T	36_H	0.662	0.37
11_A	18_S	0.660	0.37
121_E	168_C	0.658	0.37
5_H	120_I	0.658	0.37
146_H	163_T	0.658	0.37
34_M	41_V	0.656	0.37
114_S	167_I	0.640	0.36
103_I	107_Q	0.635	0.35
94_V	165_G	0.635	0.35
41_V	169_V	0.628	0.35
41_V	166_E	0.624	0.34
64_F	87_K	0.621	0.34
157_A	177_L	0.621	0.34
20_M	41_V	0.621	0.34
76_G	171_T	0.620	0.34
77_N	114_S	0.618	0.34
44_L	134_N	0.615	0.34
101_M	129_I	0.613	0.33
16_G	108_D	0.613	0.33
61_F	67_F	0.612	0.33
69_A	87_K	0.612	0.33
147_A	156_I	0.611	0.33
57_V	62_T	0.610	0.33
114_S	175_I	0.609	0.33
101_M	113_V	0.608	0.33
46_N	51_A	0.607	0.33
9_I	101_M	0.607	0.33
162_E	175_I	0.605	0.33
39_R	176_I	0.603	0.33
85_L	113_V	0.601	0.32
72_E	81_A	0.600	0.32
134_N	137_L	0.600	0.32
34_M	133_G	0.594	0.32
31_A	167_I	0.590	0.32
50_L	67_F	0.588	0.31
102_L	167_I	0.588	0.31
79_K	121_E	0.586	0.31
10_F	144_K	0.583	0.31
31_A	134_N	0.582	0.31
51_A	102_L	0.580	0.31
72_E	156_I	0.579	0.31
51_A	88_E	0.579	0.31
74_Y	85_L	0.578	0.31
19_A	177_L	0.578	0.31
6_A	9_I	0.578	0.31
5_H	129_I	0.576	0.31
74_Y	77_N	0.573	0.30
145_K	163_T	0.564	0.30
70_K	86_A	0.564	0.30
10_F	105_M	0.564	0.30
147_A	151_M	0.562	0.30
33_V	172_N	0.561	0.29
150_S	155_E	0.560	0.29
15_K	18_S	0.558	0.29
93_K	162_E	0.557	0.29
60_A	67_F	0.556	0.29
27_T	122_P	0.553	0.29
78_L	106_N	0.552	0.29
164_A	171_T	0.551	0.29
39_R	129_I	0.550	0.29
18_S	125_G	0.547	0.28
22_G	38_A	0.547	0.28
129_I	133_G	0.546	0.28
51_A	56_S	0.545	0.28
45_F	72_E	0.545	0.28
80_R	94_V	0.544	0.28
70_K	85_L	0.543	0.28
41_V	62_T	0.542	0.28
158_R	179_E	0.538	0.28
33_V	165_G	0.537	0.28
66_K	83_V	0.537	0.28
29_G	101_M	0.536	0.28
27_T	134_N	0.536	0.28
61_F	128_A	0.534	0.28
134_N	138_A	0.532	0.27
33_V	38_A	0.529	0.27
43_K	135_Y	0.528	0.27
165_G	174_Q	0.527	0.27
114_S	123_D	0.526	0.27
37_T	174_Q	0.526	0.27
11_A	114_S	0.525	0.27
80_R	97_K	0.524	0.27
159_A	163_T	0.524	0.27
56_S	174_Q	0.522	0.27
106_N	161_L	0.521	0.27
43_K	180_L	0.518	0.26
106_N	110_L	0.517	0.26
65_E	165_G	0.516	0.26
4_F	28_F	0.515	0.26
66_K	114_S	0.515	0.26
50_L	93_K	0.515	0.26
56_S	116_T	0.514	0.26
80_R	121_E	0.513	0.26
91_S	97_K	0.511	0.26
44_L	47_G	0.511	0.26
92_D	125_G	0.511	0.26
30_Q	168_C	0.505	0.26
13_Q	16_G	0.501	0.25
29_G	102_L	0.501	0.25
20_M	178_E	0.500	0.25
93_K	99_E	0.500	0.25

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1g3kA	5	0.9503	100	0.659	Contact Map
1m4yA	5	0.9448	100	0.676	Contact Map
2z3bA	5	0.989	100	0.679	Contact Map
4hnzA	5	0.9448	100	0.694	Contact Map
4r3oJ	1	0.9669	99.9	0.744	Contact Map
1rypJ	1	0.9613	99.9	0.744	Contact Map
1rypH	2	0.9613	99.9	0.747	Contact Map
4r3oN	1	0.9724	99.9	0.749	Contact Map
1yarH	5	0.9227	99.9	0.75	Contact Map
1g0uM	1	0.9779	99.9	0.751	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0073 seconds.