AROK - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

AROK - Shikimate kinase

UniProt:	P37944	Sequences: MNAKRAIPVRERNIVLIGFMGVGKTTIGQLVAKKLYRDFIDIDQQIEKDFNMSIPEIFEKKGEDFFRKTEKEYILDICHHKRFKIVSLGGGSFKQEEIRNCCLENCLVLHLDLSWENWKQRADLLIESRPVLHNRSMDEMEQLFNERKVIYDKHNSKVATDNLSPEEVADYIVETLKIGWDLYQPM	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	186 (160)
Sequences:	9799 (6819)
Seq/√Len:	539.1

ECOLI - AROL AROK KAD
BACSU - AROK KAD YQAC
HALSA - KAD KCY KAD6 Y2452
SULSO - KAD6 KCY Y1041

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
115_W	141_E	3.010	1.00
163_L	171_Y	2.983	1.00
49_D	76_D	2.884	1.00
34_K	173_V	2.747	1.00
46_I	70_E	2.294	1.00
30_L	169_A	2.293	1.00
57_I	66_F	2.250	1.00
112_D	158_V	2.215	1.00
55_P	59_E	2.208	1.00
133_H	136_S	2.166	1.00
126_I	129_R	2.023	1.00
117_N	120_Q	2.000	1.00
163_L	167_E	1.973	1.00
45_Q	48_K	1.930	1.00
53_S	56_E	1.875	1.00
28_G	39_F	1.866	1.00
34_K	169_A	1.847	1.00
141_E	145_N	1.810	1.00
138_D	142_Q	1.807	1.00
142_Q	146_E	1.693	1.00
71_K	101_C	1.684	1.00
103_L	154_H	1.666	1.00
52_M	61_K	1.658	1.00
96_E	100_N	1.640	1.00
152_D	158_V	1.563	1.00
110_H	158_V	1.549	1.00
148_K	152_D	1.544	1.00
164_S	167_E	1.522	1.00
71_K	95_Q	1.509	1.00
112_D	159_A	1.503	1.00
132_L	136_S	1.454	1.00
15_V	106_C	1.441	1.00
71_K	97_E	1.437	1.00
110_H	148_K	1.420	1.00
71_K	92_S	1.393	1.00
22_V	113_L	1.391	1.00
27_I	172_I	1.386	1.00
35_L	173_V	1.385	1.00
45_Q	73_Y	1.381	1.00
68_K	72_E	1.349	1.00
117_N	162_N	1.333	1.00
169_A	173_V	1.328	1.00
42_I	92_S	1.314	1.00
30_L	33_K	1.313	1.00
65_F	69_T	1.307	1.00
68_K	95_Q	1.305	1.00
50_F	58_F	1.286	1.00
77_I	80_H	1.273	1.00
42_I	74_I	1.265	1.00
61_K	65_F	1.261	1.00
111_L	161_D	1.237	1.00
139_E	143_L	1.235	1.00
56_E	59_E	1.232	1.00
19_F	140_M	1.206	1.00
37_R	83_F	1.194	1.00
109_L	172_I	1.192	1.00
157_K	175_T	1.190	1.00
119_K	137_M	1.188	1.00
114_S	162_N	1.174	1.00
137_M	141_E	1.172	1.00
101_C	104_E	1.165	1.00
16_L	28_G	1.162	1.00
30_L	166_E	1.153	1.00
40_I	84_K	1.152	1.00
112_D	148_K	1.147	1.00
128_S	131_V	1.146	1.00
103_L	155_N	1.143	1.00
49_D	73_Y	1.142	1.00
65_F	68_K	1.141	1.00
149_V	153_K	1.122	1.00
140_M	144_F	1.114	1.00
72_E	75_L	1.107	1.00
71_K	98_I	1.106	1.00
52_M	56_E	1.093	1.00
119_K	123_D	1.091	1.00
143_L	147_R	1.087	1.00
135_R	139_E	1.086	1.00
99_R	153_K	1.072	1.00
27_I	169_A	1.070	1.00
132_L	135_R	1.063	1.00
69_T	72_E	1.060	1.00
107_L	157_K	1.060	1.00
170_D	174_E	1.049	1.00
75_L	79_H	1.045	1.00
128_S	133_H	1.039	1.00
50_F	65_F	1.039	1.00
114_S	161_D	1.037	1.00
97_E	100_N	1.035	1.00
27_I	168_V	1.025	1.00
45_Q	49_D	1.017	1.00
100_N	104_E	1.016	1.00
94_K	146_E	1.010	1.00
130_P	133_H	1.009	1.00
56_E	61_K	1.008	1.00
32_A	39_F	1.007	1.00
113_L	118_W	1.003	1.00
44_Q	47_E	0.993	1.00
54_I	58_F	0.989	1.00
163_L	168_V	0.984	1.00
57_I	63_E	0.982	1.00
50_F	69_T	0.982	1.00
94_K	150_I	0.981	1.00
114_S	117_N	0.969	1.00
16_L	31_V	0.956	1.00
170_D	173_V	0.953	1.00
115_W	137_M	0.947	1.00
171_Y	174_E	0.946	1.00
116_E	120_Q	0.941	1.00
75_L	105_N	0.940	1.00
140_M	147_R	0.933	1.00
13_N	84_K	0.923	1.00
113_L	121_R	0.916	1.00
144_F	147_R	0.914	1.00
54_I	57_I	0.914	1.00
112_D	157_K	0.911	1.00
167_E	171_Y	0.911	1.00
29_Q	33_K	0.910	1.00
139_E	142_Q	0.901	1.00
76_D	80_H	0.899	1.00
144_F	148_K	0.898	1.00
127_E	130_P	0.889	1.00
13_N	83_F	0.875	1.00
111_L	172_I	0.867	1.00
127_E	133_H	0.866	1.00
37_R	84_K	0.862	1.00
150_I	154_H	0.858	1.00
100_N	103_L	0.855	1.00
171_Y	175_T	0.843	1.00
15_V	86_V	0.838	1.00
38_D	77_I	0.836	1.00
93_F	150_I	0.828	1.00
17_I	108_V	0.816	1.00
102_C	108_V	0.816	1.00
165_P	169_A	0.815	1.00
30_L	34_K	0.814	1.00
39_F	87_S	0.807	1.00
127_E	131_V	0.799	1.00
99_R	150_I	0.793	1.00
160_T	163_L	0.789	1.00
44_Q	48_K	0.789	1.00
19_F	118_W	0.781	1.00
47_E	53_S	0.779	1.00
149_V	152_D	0.774	1.00
113_L	117_N	0.773	1.00
102_C	106_C	0.766	1.00
13_N	37_R	0.764	1.00
66_F	69_T	0.760	1.00
135_R	138_D	0.758	1.00
115_W	119_K	0.755	1.00
71_K	74_I	0.755	1.00
129_R	132_L	0.745	1.00
140_M	143_L	0.745	1.00
29_Q	39_F	0.745	1.00
145_N	149_V	0.741	1.00
64_D	95_Q	0.739	1.00
21_G	122_A	0.738	1.00
31_V	172_I	0.738	1.00
26_T	165_P	0.733	1.00
64_D	68_K	0.731	1.00
53_S	72_E	0.727	1.00
49_D	72_E	0.726	1.00
57_I	65_F	0.721	1.00
74_I	92_S	0.721	1.00
130_P	134_N	0.718	1.00
126_I	130_P	0.718	1.00
17_I	154_H	0.715	1.00
126_I	131_V	0.708	1.00
145_N	148_K	0.705	1.00
77_I	81_K	0.704	1.00
42_I	73_Y	0.704	1.00
75_L	101_C	0.687	1.00
155_N	159_A	0.684	1.00
156_S	175_T	0.683	1.00
29_Q	32_A	0.673	1.00
34_K	170_D	0.673	1.00
134_N	139_E	0.663	1.00
27_I	165_P	0.662	1.00
136_S	139_E	0.661	1.00
25_T	29_Q	0.660	1.00
103_L	150_I	0.659	1.00
15_V	102_C	0.657	1.00
58_F	63_E	0.653	1.00
40_I	45_Q	0.650	1.00
126_I	134_N	0.649	1.00
95_Q	98_I	0.649	1.00
25_T	87_S	0.643	1.00
74_I	98_I	0.643	1.00
103_L	151_Y	0.642	1.00
42_I	77_I	0.637	1.00
43_D	47_E	0.630	1.00
66_F	70_E	0.629	1.00
22_V	110_H	0.628	1.00
41_D	87_S	0.627	1.00
113_L	160_T	0.619	1.00
108_V	156_S	0.616	1.00
143_L	146_E	0.609	1.00
28_G	32_A	0.606	1.00
32_A	85_I	0.597	1.00
15_V	78_C	0.596	1.00
71_K	75_L	0.591	1.00
147_R	151_Y	0.590	1.00
118_W	140_M	0.586	0.99
57_I	61_K	0.584	0.99
107_L	176_L	0.581	0.99
31_V	169_A	0.581	0.99
30_L	165_P	0.578	0.99
50_F	57_I	0.576	0.99
117_N	161_D	0.572	0.99
40_I	77_I	0.570	0.99
53_S	68_K	0.565	0.99
131_V	134_N	0.560	0.99
15_V	105_N	0.558	0.99
45_Q	76_D	0.558	0.99
110_H	152_D	0.552	0.99
113_L	161_D	0.551	0.99
128_S	132_L	0.549	0.99
167_E	170_D	0.548	0.99
16_L	111_L	0.547	0.99
19_F	115_W	0.546	0.99
23_G	26_T	0.542	0.99
19_F	143_L	0.540	0.99
20_M	131_V	0.536	0.99
155_N	158_V	0.535	0.99
109_L	156_S	0.534	0.99
53_S	57_I	0.531	0.99
69_T	73_Y	0.531	0.99
38_D	80_H	0.531	0.99
42_I	45_Q	0.529	0.99
99_R	154_H	0.527	0.99
31_V	85_I	0.520	0.99
96_E	99_R	0.516	0.99
48_K	77_I	0.516	0.99
38_D	81_K	0.514	0.99
103_L	106_C	0.514	0.99
17_I	148_K	0.512	0.99
67_R	97_E	0.509	0.99
52_M	57_I	0.509	0.99
107_L	155_N	0.507	0.99
20_M	58_F	0.502	0.98
54_I	72_E	0.500	0.98

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3gmtA	1	0.7849	99.9	0.443	Contact Map
4pzlA	2	0.9355	99.9	0.461	Contact Map
4qbgB	1	0.8925	99.9	0.463	Contact Map
4jzkA	1	0.871	99.9	0.463	Contact Map
3tlxA	1	0.9247	99.9	0.466	Contact Map
1akyA	1	0.8925	99.9	0.467	Contact Map
1ak2A	1	0.9086	99.9	0.468	Contact Map
1zd8A	1	0.8978	99.9	0.47	Contact Map
3be4A	1	0.8925	99.9	0.475	Contact Map
1zakA	2	0.9301	99.9	0.477	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.007 seconds.