SP2M - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

SP2M - Stage II sporulation protein M

UniProt:	P37873	Sequences: MRKISYKDMFLRHVKDHLSLYIFVSVLFFMGVIFGAIIVNSMTISQKEDLYYYLSQFFGQLSDGKQASSADMFGQSIFHNAKYLGLMWILGISVIGMPIIFIMIFLKGIVVGFTVGFLVNQMGVSGFFLSFVSVLPQNVLLIPAYLIMGTCAIAFSLKLIRQLFVKRSLHDAPIQWFGRYAFVLLVILFLALISSLFEAYLSPVLMEKLTSRLF	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	214 (199)
Sequences:	368 (317)
Seq/√Len:	22.5

BACSU - SP2M

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
13_H	21_Y	5.107	1.00
87_M	149_G	4.421	1.00
104_I	149_G	3.759	1.00
50_L	117_F	2.778	0.99
80_N	139_V	2.732	0.99
88_W	181_A	2.563	0.98
106_L	201_L	2.486	0.98
189_F	193_I	2.472	0.98
88_W	180_Y	2.447	0.98
184_L	193_I	2.294	0.97
25_S	186_V	2.268	0.97
107_K	111_V	2.253	0.96
28_F	142_I	2.251	0.96
152_A	156_S	2.120	0.95
155_F	174_I	2.113	0.95
108_G	143_P	2.100	0.95
125_S	149_G	1.991	0.93
43_T	140_L	1.952	0.92
27_L	107_K	1.932	0.92
24_V	28_F	1.927	0.92
14_V	179_R	1.892	0.91
95_I	159_L	1.791	0.88
141_L	191_A	1.767	0.88
135_L	149_G	1.731	0.87
81_A	183_V	1.694	0.85
88_W	153_I	1.683	0.85
99_I	134_V	1.659	0.84
73_F	77_I	1.651	0.84
144_A	187_I	1.642	0.84
140_L	144_A	1.640	0.84
90_L	96_G	1.624	0.83
25_S	94_V	1.615	0.83
117_F	156_S	1.598	0.82
36_A	127_F	1.592	0.82
131_F	207_E	1.575	0.81
27_L	105_F	1.535	0.79
70_A	140_L	1.532	0.79
34_F	93_S	1.530	0.79
28_F	129_L	1.509	0.78
46_Q	82_K	1.490	0.77
90_L	93_S	1.447	0.75
95_I	105_F	1.441	0.75
34_F	105_F	1.438	0.74
26_V	34_F	1.418	0.73
54_L	58_F	1.417	0.73
80_N	92_I	1.417	0.73
181_A	185_L	1.398	0.72
183_V	197_F	1.396	0.72
32_V	187_I	1.389	0.72
36_A	116_G	1.388	0.72
83_Y	163_L	1.386	0.72
102_I	191_A	1.385	0.72
28_F	143_P	1.372	0.71
139_V	185_L	1.367	0.71
81_A	142_I	1.331	0.68
66_Q	192_L	1.325	0.68
73_F	130_S	1.317	0.68
21_Y	98_P	1.311	0.67
81_A	139_V	1.309	0.67
23_F	93_S	1.302	0.67
92_I	139_V	1.277	0.65
138_N	198_E	1.262	0.64
147_I	183_V	1.260	0.64
85_G	88_W	1.258	0.64
58_F	93_S	1.250	0.63
134_V	141_L	1.249	0.63
101_F	203_P	1.248	0.63
62_S	199_A	1.248	0.63
152_A	184_L	1.247	0.63
24_V	142_I	1.234	0.62
132_V	209_L	1.225	0.62
70_A	191_A	1.215	0.61
94_V	199_A	1.201	0.60
81_A	99_I	1.199	0.60
58_F	127_F	1.194	0.60
50_L	53_Y	1.191	0.60
146_L	209_L	1.180	0.59
45_S	193_I	1.176	0.59
89_I	160_I	1.174	0.58
32_V	48_E	1.173	0.58
53_Y	57_F	1.167	0.58
80_N	141_L	1.166	0.58
13_H	29_F	1.158	0.57
23_F	122_M	1.158	0.57
23_F	105_F	1.143	0.56
45_S	100_I	1.135	0.56
41_S	104_I	1.122	0.55
73_F	188_L	1.102	0.54
104_I	110_V	1.099	0.53
160_I	165_V	1.094	0.53
32_V	89_I	1.089	0.53
61_L	69_S	1.089	0.53
127_F	130_S	1.085	0.52
182_F	190_L	1.080	0.52
157_L	161_R	1.075	0.52
196_L	209_L	1.073	0.52
42_M	173_P	1.067	0.51
37_I	47_K	1.067	0.51
99_I	172_A	1.064	0.51
122_M	137_Q	1.050	0.50
80_N	109_I	1.050	0.50
90_L	203_P	1.047	0.50
99_I	180_Y	1.045	0.50
33_I	153_I	1.044	0.50
10_F	193_I	1.041	0.49
93_S	105_F	1.037	0.49
57_F	76_S	1.036	0.49
42_M	132_V	1.031	0.49
101_F	153_I	1.028	0.49
186_V	204_V	1.004	0.47
140_L	197_F	1.004	0.47
108_G	138_N	1.000	0.47
77_I	81_A	0.989	0.46
26_V	131_F	0.988	0.46
185_L	193_I	0.985	0.46
148_M	193_I	0.971	0.45
98_P	101_F	0.970	0.45
42_M	88_W	0.969	0.44
13_H	17_H	0.968	0.44
21_Y	101_F	0.967	0.44
36_A	180_Y	0.965	0.44
154_A	206_M	0.962	0.44
23_F	27_L	0.951	0.43
144_A	195_S	0.949	0.43
14_V	182_F	0.935	0.42
159_L	163_L	0.903	0.40
25_S	146_L	0.901	0.40
20_L	164_F	0.899	0.40
28_F	63_D	0.888	0.39
42_M	203_P	0.887	0.39
21_Y	161_R	0.882	0.39
84_L	184_L	0.872	0.38
29_F	129_L	0.870	0.38
77_I	87_M	0.870	0.38
38_I	109_I	0.862	0.37
63_D	139_V	0.859	0.37
84_L	168_S	0.854	0.37
111_V	206_M	0.849	0.37
27_L	109_I	0.847	0.36
166_K	184_L	0.847	0.36
73_F	199_A	0.844	0.36
18_L	135_L	0.841	0.36
145_Y	152_A	0.841	0.36
173_P	181_A	0.835	0.36
47_K	107_K	0.831	0.35
144_A	194_S	0.830	0.35
129_L	152_A	0.825	0.35
26_V	124_V	0.824	0.35
23_F	67_A	0.822	0.35
34_F	134_V	0.818	0.35
69_S	199_A	0.814	0.34
93_S	96_G	0.812	0.34
34_F	177_F	0.811	0.34
27_L	38_I	0.805	0.34
120_N	184_L	0.802	0.34
57_F	198_E	0.801	0.34
32_V	124_V	0.798	0.33
83_Y	171_D	0.794	0.33
103_M	208_K	0.794	0.33
181_A	188_L	0.787	0.33
95_I	210_T	0.786	0.33
28_F	197_F	0.783	0.32
102_I	119_V	0.781	0.32
119_V	144_A	0.780	0.32
88_W	155_F	0.770	0.32
160_I	195_S	0.762	0.31
36_A	58_F	0.755	0.31
9_M	192_L	0.750	0.31
12_R	16_D	0.745	0.30
15_K	123_G	0.745	0.30
133_S	143_P	0.745	0.30
137_Q	141_L	0.740	0.30
140_L	207_E	0.739	0.30
157_L	189_F	0.736	0.30
138_N	143_P	0.734	0.30
45_S	52_Y	0.734	0.30
23_F	116_G	0.730	0.29
41_S	107_K	0.729	0.29
14_V	191_A	0.729	0.29
29_F	75_Q	0.725	0.29
155_F	177_F	0.722	0.29
136_P	198_E	0.720	0.29
61_L	78_F	0.715	0.29
10_F	14_V	0.705	0.28
43_T	160_I	0.695	0.27
83_Y	110_V	0.691	0.27
129_L	191_A	0.688	0.27
95_I	177_F	0.683	0.27
205_L	210_T	0.675	0.26
91_G	146_L	0.674	0.26
34_F	97_M	0.674	0.26
86_L	116_G	0.669	0.26
73_F	109_I	0.667	0.26
15_K	178_G	0.660	0.26
12_R	22_I	0.659	0.25
148_M	155_F	0.657	0.25
168_S	185_L	0.655	0.25
22_I	95_I	0.655	0.25
77_I	167_R	0.655	0.25
23_F	102_I	0.654	0.25
15_K	190_L	0.654	0.25
15_K	45_S	0.652	0.25
60_Q	122_M	0.650	0.25
113_F	180_Y	0.648	0.25
46_Q	118_L	0.645	0.25
70_A	74_G	0.643	0.25
91_G	180_Y	0.643	0.25
72_M	83_Y	0.640	0.24
84_L	207_E	0.640	0.24
87_M	152_A	0.639	0.24
20_L	86_L	0.636	0.24
193_I	201_L	0.636	0.24
24_V	138_N	0.632	0.24
22_I	205_L	0.630	0.24
22_I	33_I	0.629	0.24
48_E	52_Y	0.629	0.24
42_M	142_I	0.628	0.24
17_H	48_E	0.627	0.24
21_Y	39_V	0.626	0.24
15_K	163_L	0.625	0.24
56_Q	100_I	0.624	0.24
63_D	186_V	0.624	0.24
106_L	167_R	0.624	0.24
75_Q	130_S	0.622	0.24
186_V	201_L	0.614	0.23
100_I	209_L	0.612	0.23
15_K	139_V	0.611	0.23
39_V	116_G	0.610	0.23
24_V	153_I	0.607	0.23
136_P	157_L	0.604	0.23
20_L	145_Y	0.603	0.23
54_L	113_F	0.602	0.23
120_N	130_S	0.602	0.23
105_F	195_S	0.602	0.23
69_S	200_Y	0.599	0.22
15_K	193_I	0.598	0.22
37_I	70_A	0.597	0.22
19_S	103_M	0.596	0.22
114_T	207_E	0.596	0.22
91_G	96_G	0.593	0.22
116_G	121_Q	0.592	0.22
184_L	190_L	0.591	0.22
142_I	188_L	0.591	0.22
188_L	201_L	0.590	0.22
33_I	200_Y	0.590	0.22
182_F	193_I	0.589	0.22
127_F	142_I	0.588	0.22
23_F	201_L	0.588	0.22
190_L	194_S	0.586	0.22
35_G	108_G	0.585	0.22
18_L	22_I	0.585	0.22
146_L	180_Y	0.581	0.22
151_C	180_Y	0.578	0.21
107_K	149_G	0.576	0.21
185_L	189_F	0.576	0.21
24_V	104_I	0.561	0.21
192_L	197_F	0.558	0.21
114_T	202_S	0.555	0.20
71_D	199_A	0.555	0.20
106_L	197_F	0.554	0.20
47_K	58_F	0.553	0.20
15_K	81_A	0.548	0.20
139_V	165_V	0.547	0.20
20_L	54_L	0.545	0.20
124_V	206_M	0.542	0.20
93_S	115_V	0.540	0.20
23_F	34_F	0.539	0.20
58_F	116_G	0.538	0.20
166_K	199_A	0.538	0.20
92_I	180_Y	0.535	0.20
27_L	34_F	0.533	0.19
11_L	15_K	0.532	0.19
99_I	142_I	0.532	0.19
54_L	115_V	0.529	0.19
69_S	140_L	0.529	0.19
100_I	152_A	0.526	0.19
51_Y	135_L	0.523	0.19
82_K	111_V	0.522	0.19
31_G	35_G	0.520	0.19
174_I	190_L	0.518	0.19
101_F	207_E	0.517	0.19
36_A	115_V	0.516	0.19
184_L	188_L	0.514	0.19
26_V	146_L	0.510	0.19
131_F	153_I	0.509	0.18
44_I	124_V	0.508	0.18
77_I	109_I	0.508	0.18
72_M	165_V	0.507	0.18
17_H	70_A	0.507	0.18
37_I	59_G	0.505	0.18
14_V	178_G	0.505	0.18
71_D	192_L	0.503	0.18
36_A	86_L	0.501	0.18
116_G	134_V	0.501	0.18
93_S	108_G	0.501	0.18
129_L	206_M	0.500	0.18
95_I	98_P	0.500	0.18
50_L	114_T	0.500	0.18

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1orqC	4	0.514	13.2	0.95	Contact Map
3wu2L	1	0.1729	8.4	0.954	Contact Map
2nwlA	3	0.8645	6.9	0.956	Contact Map
2m8rA	1	0.2009	6.2	0.956	Contact Map
3w4tA	1	0.6215	3.5	0.961	Contact Map
2y69J	1	0.2103	2.9	0.963	Contact Map
3mktA	1	0.6916	2.8	0.963	Contact Map
3d31C	2	0.8598	2.4	0.965	Contact Map
4lz6A	1	0.6308	2.2	0.965	Contact Map
4dxwA	3	0.5327	2.2	0.965	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0078 seconds.