ATPL - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

ATPL - ATP synthase subunit c

UniProt:	P37815	Sequences: MNLIAAAIAIGLGALGAGIGNGLIVSRTVEGIARQPEAGKELRTLMFMGIALVEALPIIAVVIAFLAFFG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	70 (65)
Sequences:	575 (292)
Seq/√Len:	36.3

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
27_R	30_E	4.697	1.00
10_I	60_A	3.143	1.00
13_G	60_A	2.800	1.00
39_G	43_R	2.713	1.00
56_L	59_I	2.305	0.99
28_T	42_L	2.206	0.99
17_A	57_P	1.912	0.98
21_N	54_E	1.817	0.97
55_A	62_V	1.675	0.95
38_A	42_L	1.672	0.95
62_V	65_F	1.642	0.95
32_I	42_L	1.589	0.94
29_V	45_L	1.494	0.91
21_N	25_V	1.490	0.91
18_G	68_F	1.485	0.91
8_I	12_L	1.465	0.91
25_V	50_I	1.462	0.91
9_A	64_A	1.437	0.90
32_I	38_A	1.410	0.89
5_A	9_A	1.388	0.88
23_L	26_S	1.385	0.88
21_N	50_I	1.331	0.86
29_V	32_I	1.242	0.82
50_I	53_V	1.206	0.80
21_N	56_L	1.125	0.75
7_A	23_L	1.087	0.72
53_V	56_L	1.067	0.71
31_G	53_V	1.063	0.70
4_I	41_E	1.050	0.70
48_M	51_A	1.026	0.68
35_Q	54_E	1.019	0.67
25_V	53_V	0.993	0.65
21_N	55_A	0.988	0.65
21_N	28_T	0.968	0.63
64_A	68_F	0.954	0.62
46_M	50_I	0.948	0.61
37_E	40_K	0.916	0.59
34_R	38_A	0.915	0.59
47_F	52_L	0.911	0.58
30_E	36_P	0.907	0.58
13_G	52_L	0.901	0.58
39_G	44_T	0.888	0.56
5_A	63_I	0.887	0.56
15_L	26_S	0.884	0.56
25_V	49_G	0.843	0.53
52_L	55_A	0.838	0.52
33_A	46_M	0.782	0.47
21_N	57_P	0.778	0.47
38_A	54_E	0.775	0.47
21_N	53_V	0.773	0.46
8_I	49_G	0.769	0.46
14_A	25_V	0.768	0.46
47_F	50_I	0.746	0.44
3_L	26_S	0.728	0.43
24_I	59_I	0.725	0.42
14_A	56_L	0.718	0.42
4_I	18_G	0.704	0.41
16_G	51_A	0.704	0.41
4_I	44_T	0.694	0.40
10_I	14_A	0.692	0.40
46_M	49_G	0.686	0.39
6_A	68_F	0.676	0.38
10_I	64_A	0.669	0.38
14_A	60_A	0.650	0.36
28_T	46_M	0.639	0.35
28_T	55_A	0.632	0.35
8_I	62_V	0.612	0.33
48_M	52_L	0.612	0.33
16_G	20_G	0.608	0.33
8_I	50_I	0.602	0.32
34_R	37_E	0.598	0.32
61_V	65_F	0.589	0.31
14_A	19_I	0.585	0.31
41_E	44_T	0.569	0.30
25_V	52_L	0.567	0.30
19_I	39_G	0.566	0.30
23_L	60_A	0.566	0.30
28_T	47_F	0.549	0.28
14_A	49_G	0.547	0.28
7_A	41_E	0.547	0.28
15_L	34_R	0.547	0.28
51_A	67_A	0.541	0.28
7_A	60_A	0.541	0.28
45_L	62_V	0.539	0.28
38_A	63_I	0.537	0.28
19_I	40_K	0.530	0.27
32_I	45_L	0.529	0.27
51_A	61_V	0.527	0.27
8_I	29_V	0.525	0.27
6_A	36_P	0.525	0.27
26_S	45_L	0.524	0.27
7_A	18_G	0.518	0.26
23_L	31_G	0.513	0.26
38_A	41_E	0.513	0.26
50_I	56_L	0.508	0.26
47_F	65_F	0.507	0.25
4_I	8_I	0.505	0.25
34_R	46_M	0.500	0.25

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4cbkA	3	0.9857	99.7	0.258	Contact Map
4v1gA	3	1	99.7	0.286	Contact Map
1a91A	1	1	99.7	0.287	Contact Map
2xquA	3	1	99.7	0.292	Contact Map
1wu0A	1	1	99.7	0.294	Contact Map
4bemA	3	0.9857	99.6	0.308	Contact Map
2xndJ	3	0.9714	99.6	0.308	Contact Map
3zk1A	5	0.9857	99.6	0.309	Contact Map
4f4sA	3	0.9857	99.6	0.314	Contact Map
4bemJ	1	0.9857	99.6	0.32	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0044 seconds.