CSAA - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

CSAA - Protein CsaA

UniProt:	P37584	Sequences: MAVIDDFEKLDIRTGTIVKAEEFPEARVPAIKLVIDFGTEIGIKQSSAQITKRYKPEGLINKQVIAVVNFPPRRIAGFKSEVLVLGGIPGQGDVVLLQPDQPVPNGTKIG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	110 (105)
Sequences:	3530 (2038)
Seq/√Len:	198.9

ECOLI - YGJH SYM
BACSU - CSAA SYM
HALSA - SYM
SULSO - Q7LXR5

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
19_K	34_V	3.151	1.00
16_T	63_Q	2.865	1.00
16_T	105_N	2.784	1.00
22_E	51_T	2.758	1.00
6_D	9_K	2.711	1.00
55_K	58_G	2.425	1.00
26_A	76_A	1.993	1.00
21_E	32_K	1.911	1.00
62_K	98_Q	1.896	1.00
12_I	65_I	1.894	1.00
37_F	66_A	1.852	1.00
15_G	35_I	1.820	1.00
3_V	6_D	1.756	1.00
34_V	43_I	1.755	1.00
23_F	32_K	1.669	1.00
47_S	78_F	1.626	1.00
18_V	43_I	1.600	1.00
46_S	82_V	1.599	1.00
22_E	56_P	1.570	1.00
19_K	60_I	1.569	1.00
4_I	8_E	1.567	1.00
46_S	66_A	1.525	1.00
31_I	56_P	1.524	1.00
63_Q	102_P	1.486	1.00
45_Q	78_F	1.427	1.00
32_K	78_F	1.419	1.00
65_I	97_L	1.396	1.00
34_V	45_Q	1.391	1.00
47_S	75_I	1.386	1.00
2_A	10_L	1.377	1.00
33_L	84_V	1.334	1.00
10_L	67_V	1.321	1.00
15_G	66_A	1.283	1.00
20_A	56_P	1.282	1.00
17_I	64_V	1.272	1.00
52_K	93_D	1.272	1.00
27_R	76_A	1.260	1.00
13_R	68_V	1.226	1.00
97_L	109_I	1.215	1.00
33_L	86_G	1.214	1.00
89_P	93_D	1.202	1.00
5_D	8_E	1.185	1.00
11_D	108_K	1.180	1.00
14_T	63_Q	1.131	1.00
36_D	105_N	1.122	1.00
74_R	79_K	1.098	1.00
65_I	87_G	1.093	1.00
35_I	82_V	1.079	1.00
14_T	65_I	1.074	1.00
20_A	31_I	1.067	1.00
12_I	85_L	1.049	1.00
25_E	77_G	1.038	1.00
37_F	68_V	1.037	1.00
37_F	42_G	1.029	1.00
62_K	100_D	1.008	1.00
87_G	109_I	1.003	1.00
63_Q	105_N	0.998	1.00
20_A	60_I	0.998	1.00
32_K	45_Q	0.989	1.00
35_I	64_V	0.987	1.00
23_F	78_F	0.970	0.99
16_T	36_D	0.964	0.99
104_P	107_T	0.963	0.99
20_A	33_L	0.948	0.99
12_I	67_V	0.947	0.99
27_R	52_K	0.932	0.99
88_I	92_G	0.931	0.99
25_E	76_A	0.918	0.99
88_I	94_V	0.911	0.99
87_G	107_T	0.905	0.99
46_S	84_V	0.898	0.99
36_D	41_I	0.894	0.99
36_D	43_I	0.886	0.99
95_V	101_Q	0.878	0.99
98_Q	101_Q	0.878	0.99
18_V	36_D	0.873	0.99
21_E	34_V	0.868	0.99
16_T	102_P	0.864	0.99
33_L	48_A	0.859	0.99
88_I	107_T	0.852	0.99
47_S	73_R	0.851	0.99
3_V	71_P	0.844	0.99
87_G	103_V	0.841	0.98
87_G	97_L	0.837	0.98
74_R	77_G	0.832	0.98
48_A	86_G	0.831	0.98
42_G	81_E	0.826	0.98
56_P	60_I	0.818	0.98
53_R	89_P	0.810	0.98
53_R	94_V	0.805	0.98
15_G	37_F	0.798	0.98
35_I	66_A	0.797	0.98
11_D	68_V	0.796	0.98
35_I	84_V	0.794	0.98
72_P	81_E	0.794	0.98
89_P	92_G	0.791	0.98
26_A	51_T	0.780	0.98
23_F	77_G	0.772	0.97
4_I	73_R	0.769	0.97
66_A	82_V	0.756	0.97
65_I	109_I	0.751	0.97
31_I	51_T	0.745	0.97
64_V	84_V	0.737	0.97
49_Q	75_I	0.713	0.96
37_F	41_I	0.710	0.96
33_L	59_L	0.684	0.95
95_V	103_V	0.674	0.94
14_T	99_P	0.668	0.94
14_T	103_V	0.666	0.94
13_R	108_K	0.661	0.94
86_G	96_L	0.648	0.93
45_Q	77_G	0.640	0.93
45_Q	79_K	0.639	0.93
95_V	100_D	0.634	0.92
85_L	109_I	0.630	0.92
44_K	81_E	0.620	0.91
55_K	59_L	0.614	0.91
44_K	82_V	0.604	0.90
30_A	49_Q	0.604	0.90
53_R	93_D	0.602	0.90
35_I	46_S	0.600	0.90
54_Y	59_L	0.600	0.90
49_Q	83_L	0.596	0.90
103_V	107_T	0.593	0.90
33_L	46_S	0.587	0.89
37_F	43_I	0.582	0.89
44_K	68_V	0.580	0.89
72_P	79_K	0.578	0.88
95_V	99_P	0.577	0.88
85_L	97_L	0.575	0.88
63_Q	99_P	0.570	0.88
20_A	48_A	0.559	0.87
24_P	27_R	0.556	0.86
15_G	43_I	0.556	0.86
25_E	32_K	0.554	0.86
59_L	96_L	0.552	0.86
89_P	107_T	0.550	0.86
54_Y	96_L	0.549	0.86
23_F	26_A	0.548	0.86
53_R	88_I	0.547	0.85
67_V	70_F	0.541	0.85
63_Q	103_V	0.539	0.85
17_I	59_L	0.531	0.84
99_P	103_V	0.529	0.84
34_V	78_F	0.528	0.83
102_P	105_N	0.522	0.83
73_R	82_V	0.520	0.83
17_I	96_L	0.520	0.83
6_D	10_L	0.518	0.82
63_Q	98_Q	0.517	0.82
36_D	42_G	0.515	0.82
84_V	96_L	0.511	0.81
66_A	84_V	0.508	0.81
52_K	91_Q	0.508	0.81
62_K	96_L	0.506	0.81
18_V	34_V	0.502	0.80
30_A	47_S	0.501	0.80
12_I	68_V	0.500	0.80

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3g48A	2	0.9909	100	0.207	Contact Map
2nzhA	5	1	100	0.21	Contact Map
1gd7A	2	0.9818	100	0.212	Contact Map
2cwpA	2	0.9727	100	0.222	Contact Map
2q2hA	2	1	100	0.222	Contact Map
2q2iA	2	1	100	0.223	Contact Map
3ersX	2	0.9727	100	0.23	Contact Map
1mkhA	2	0.9545	100	0.233	Contact Map
1pybA	2	0.9636	100	0.237	Contact Map
1rqgA	2	0	100	0.259	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0055 seconds.