MCSA - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

MCSA - Protein-arginine kinase activator protein

UniProt:	P37569	Sequences: MICQECHERPATFHFTKVVNGEKIEVHICEQCAKENSDSYGISANQGFSIHNLLSGLLNMDSSFQNAGTQMFSHSEQISACPKCGMTFQQFRKIGRFGCSECYKTFHSNITPILRKVHSGNTVHAGKIPKRIGGNLHVRRQIDMLKKELESLIHQEEFENAAHVRDQIRLLEQSLKSTDSEEEQE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	185 (167)
Sequences:	574 (474)
Seq/√Len:	36.6

BACSU - MCSA

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
160_N	163_H	6.568	1.00
83_K	101_E	5.338	1.00
152_L	164_V	5.146	1.00
141_Q	167_Q	5.139	1.00
9_R	31_Q	4.399	1.00
157_E	160_N	4.393	1.00
146_K	172_E	4.174	1.00
82_P	105_T	3.120	1.00
148_E	160_N	2.924	1.00
167_Q	170_L	2.624	1.00
17_K	38_D	2.536	1.00
4_Q	27_H	2.485	1.00
5_E	36_N	2.330	1.00
162_A	166_D	2.160	0.99
88_F	91_F	2.108	0.99
162_A	165_R	2.080	0.99
8_E	158_F	1.787	0.97
142_I	168_I	1.781	0.97
88_F	110_I	1.740	0.96
78_I	89_Q	1.730	0.96
148_E	164_V	1.691	0.96
16_T	23_K	1.687	0.96
151_S	155_Q	1.618	0.94
3_C	6_C	1.608	0.94
118_H	124_H	1.605	0.94
141_Q	144_M	1.592	0.94
113_I	117_V	1.561	0.93
150_E	154_H	1.540	0.93
148_E	167_Q	1.454	0.91
118_H	121_N	1.433	0.90
163_H	167_Q	1.429	0.90
86_M	91_F	1.416	0.89
142_I	171_L	1.395	0.89
14_H	27_H	1.389	0.88
114_L	118_H	1.384	0.88
101_E	104_K	1.334	0.86
82_P	101_E	1.327	0.86
2_I	7_H	1.317	0.86
48_F	57_L	1.316	0.86
91_F	156_E	1.295	0.85
84_C	99_C	1.279	0.84
124_H	127_K	1.266	0.83
54_L	124_H	1.261	0.83
109_N	140_R	1.253	0.83
54_L	133_G	1.225	0.81
144_M	148_E	1.180	0.79
90_Q	158_F	1.146	0.77
138_V	174_S	1.126	0.75
6_C	11_A	1.105	0.74
86_M	94_I	1.096	0.73
115_R	130_K	1.093	0.73
79_S	105_T	1.092	0.73
33_A	98_G	1.082	0.72
44_A	50_I	1.077	0.72
138_V	142_I	1.067	0.71
8_E	172_E	1.048	0.70
154_H	158_F	1.043	0.69
46_Q	55_S	1.039	0.69
84_C	126_G	1.026	0.68
99_C	126_G	1.026	0.68
27_H	97_F	1.024	0.68
147_K	169_R	1.024	0.68
7_H	85_G	1.014	0.67
14_H	131_R	1.008	0.67
153_I	174_S	1.007	0.67
3_C	11_A	0.990	0.65
79_S	109_N	0.985	0.65
138_V	171_L	0.979	0.64
24_I	94_I	0.974	0.64
34_K	55_S	0.974	0.64
82_P	85_G	0.972	0.64
29_C	32_C	0.966	0.63
130_K	174_S	0.964	0.63
95_G	118_H	0.959	0.63
18_V	113_I	0.935	0.61
13_F	37_S	0.932	0.61
18_V	88_F	0.925	0.60
12_T	27_H	0.921	0.60
81_C	84_C	0.920	0.60
81_C	99_C	0.920	0.60
31_Q	35_E	0.911	0.59
163_H	170_L	0.906	0.58
2_I	8_E	0.905	0.58
1_M	6_C	0.903	0.58
16_T	27_H	0.898	0.58
168_I	172_E	0.895	0.57
100_S	150_E	0.888	0.57
6_C	29_C	0.880	0.56
16_T	91_F	0.875	0.56
41_G	44_A	0.871	0.55
35_E	63_S	0.865	0.55
47_G	51_H	0.859	0.54
92_R	97_F	0.851	0.54
163_H	169_R	0.843	0.53
145_L	152_L	0.842	0.53
149_L	158_F	0.839	0.53
95_G	113_I	0.838	0.52
10_P	118_H	0.830	0.52
152_L	160_N	0.828	0.52
14_H	25_E	0.828	0.52
133_G	139_R	0.827	0.52
3_C	29_C	0.826	0.51
17_K	37_S	0.824	0.51
16_T	97_F	0.814	0.50
25_E	58_L	0.811	0.50
48_F	56_G	0.806	0.50
25_E	52_N	0.804	0.50
60_M	96_R	0.803	0.49
149_L	152_L	0.800	0.49
105_T	109_N	0.794	0.49
134_G	148_E	0.793	0.49
155_Q	160_N	0.789	0.48
56_G	116_K	0.785	0.48
22_E	139_R	0.780	0.47
170_L	173_Q	0.775	0.47
15_F	36_N	0.766	0.46
95_G	103_Y	0.765	0.46
13_F	47_G	0.764	0.46
169_R	173_Q	0.761	0.46
17_K	50_I	0.760	0.46
1_M	32_C	0.757	0.45
84_C	102_C	0.753	0.45
99_C	102_C	0.753	0.45
10_P	138_V	0.752	0.45
9_R	100_S	0.751	0.45
97_F	107_H	0.749	0.45
170_L	174_S	0.745	0.44
4_Q	57_L	0.744	0.44
90_Q	139_R	0.742	0.44
58_L	96_R	0.741	0.44
1_M	11_A	0.739	0.44
169_R	172_E	0.734	0.43
115_R	122_T	0.732	0.43
49_S	88_F	0.722	0.42
116_K	131_R	0.722	0.42
28_I	152_L	0.719	0.42
58_L	93_K	0.717	0.42
17_K	24_I	0.715	0.42
93_K	135_N	0.710	0.41
161_A	165_R	0.709	0.41
104_K	148_E	0.709	0.41
141_Q	174_S	0.706	0.41
110_I	114_L	0.704	0.41
7_H	86_M	0.704	0.41
26_V	90_Q	0.704	0.41
46_Q	50_I	0.703	0.41
135_N	163_H	0.701	0.41
19_V	24_I	0.700	0.41
84_C	98_G	0.696	0.40
12_T	19_V	0.693	0.40
96_R	105_T	0.690	0.40
142_I	174_S	0.690	0.40
54_L	139_R	0.688	0.39
144_M	147_K	0.687	0.39
91_F	118_H	0.687	0.39
51_H	59_N	0.686	0.39
54_L	61_D	0.686	0.39
81_C	126_G	0.686	0.39
105_T	108_S	0.686	0.39
37_S	53_L	0.686	0.39
51_H	114_L	0.683	0.39
35_E	140_R	0.677	0.39
101_E	105_T	0.677	0.39
141_Q	170_L	0.676	0.38
94_I	97_F	0.676	0.38
23_K	55_S	0.671	0.38
145_L	164_V	0.670	0.38
24_I	171_L	0.663	0.37
107_H	151_S	0.662	0.37
13_F	28_I	0.662	0.37
79_S	91_F	0.661	0.37
47_G	88_F	0.659	0.37
64_F	94_I	0.657	0.37
60_M	90_Q	0.655	0.37
102_C	115_R	0.647	0.36
83_K	100_S	0.645	0.36
49_S	129_P	0.642	0.36
96_R	169_R	0.642	0.36
134_G	153_I	0.640	0.36
24_I	173_Q	0.640	0.36
93_K	171_L	0.639	0.35
14_H	118_H	0.636	0.35
16_T	95_G	0.636	0.35
123_V	167_Q	0.631	0.35
52_N	57_L	0.629	0.35
25_E	33_A	0.617	0.34
148_E	151_S	0.615	0.34
113_I	132_I	0.613	0.33
1_M	10_P	0.603	0.33
8_E	19_V	0.601	0.32
92_R	107_H	0.600	0.32
104_K	107_H	0.598	0.32
82_P	107_H	0.595	0.32
86_M	120_G	0.592	0.32
15_F	124_H	0.592	0.32
33_A	166_D	0.590	0.32
111_T	114_L	0.590	0.32
66_N	173_Q	0.588	0.31
46_Q	114_L	0.588	0.31
41_G	147_K	0.588	0.31
34_K	146_K	0.586	0.31
147_K	151_S	0.585	0.31
53_L	122_T	0.578	0.31
81_C	102_C	0.574	0.30
13_F	156_E	0.567	0.30
94_I	148_E	0.566	0.30
149_L	168_I	0.566	0.30
65_Q	143_D	0.565	0.30
63_S	74_H	0.563	0.30
142_I	155_Q	0.562	0.30
18_V	83_K	0.562	0.30
89_Q	164_V	0.562	0.30
6_C	32_C	0.558	0.29
58_L	92_R	0.556	0.29
97_F	114_L	0.555	0.29
58_L	151_S	0.553	0.29
88_F	109_N	0.552	0.29
77_Q	170_L	0.550	0.29
95_G	100_S	0.550	0.29
10_P	158_F	0.549	0.29
50_I	57_L	0.547	0.28
4_Q	12_T	0.547	0.28
88_F	115_R	0.545	0.28
126_G	129_P	0.541	0.28
53_L	88_F	0.540	0.28
64_F	137_H	0.539	0.28
73_S	89_Q	0.539	0.28
59_N	92_R	0.536	0.28
9_R	59_N	0.536	0.28
132_I	136_L	0.535	0.28
25_E	120_G	0.534	0.28
108_S	112_P	0.532	0.27
74_H	125_A	0.530	0.27
34_K	89_Q	0.526	0.27
112_P	134_G	0.524	0.27
153_I	162_A	0.520	0.27
86_M	156_E	0.520	0.27
123_V	170_L	0.520	0.27
29_C	156_E	0.519	0.26
23_K	35_E	0.518	0.26
34_K	83_K	0.518	0.26
14_H	95_G	0.514	0.26
73_S	164_V	0.509	0.26
65_Q	154_H	0.507	0.26
56_G	131_R	0.507	0.26
32_C	102_C	0.506	0.26
15_F	117_V	0.506	0.26
3_C	32_C	0.504	0.25
63_S	92_R	0.502	0.25
8_E	75_S	0.500	0.25

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1e52A	2	0.2865	97.9	0.85	Contact Map
1c4oA	1	0.6973	97	0.873	Contact Map
2d7dA	2	0.5838	96.1	0.886	Contact Map
4kblA	2	0.827	76.5	0.924	Contact Map
4cgyA	1	0	72.8	0.926	Contact Map
1tfiA	1	0.2108	52.9	0.935	Contact Map
1vd4A	1	0.2973	52.4	0.936	Contact Map
2jtnA	1	0.5622	50.3	0.936	Contact Map
2i13A	1	0.5676	49.9	0.936	Contact Map
3w5kB	1	0.5081	49.7	0.936	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0068 seconds.