YABQ - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YABQ - Spore protein YabQ

UniProt:	P37559	Sequences: MTLTTQFYTMLAMSGMGLWLGASLDTYRLFVIRAKTARWLLFIHDILFWIMQGLLFFYVLLHVNEGEFRIYIFLAVLLGVATYQSLCKRIYIKILKFVIYLVVSVYQFFKKLIQHVLFRPIVWTCGAIIWLAAFLFKKTYSLIGFLLLCLYKIVMVLCFPIRFIAKQCLKLLPVKMRLTFRRYFEKGAGFLKKKKKLLITIRTTITRFLKR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	211 (186)
Sequences:	210 (182)
Seq/√Len:	13.3

BACSU - YABQ

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
29_L	96_K	3.967	1.00
84_Q	88_K	3.844	0.99
26_T	91_Y	3.637	0.99
27_Y	45_D	3.376	0.99
50_I	108_F	2.478	0.91
91_Y	95_L	2.346	0.88
19_W	61_L	2.302	0.87
1_M	9_T	2.294	0.87
29_L	88_K	2.269	0.87
3_L	6_Q	2.142	0.83
60_L	64_N	2.130	0.83
51_M	55_L	2.089	0.82
130_W	133_A	1.996	0.78
106_Y	110_K	1.995	0.78
48_F	95_L	1.925	0.76
1_M	6_Q	1.907	0.75
26_T	95_L	1.858	0.73
59_V	77_L	1.839	0.72
49_W	64_N	1.723	0.67
9_T	13_M	1.720	0.67
24_L	75_A	1.719	0.67
7_F	48_F	1.681	0.65
58_Y	95_L	1.663	0.64
125_C	137_K	1.641	0.63
47_L	54_L	1.630	0.63
121_I	157_L	1.623	0.62
76_V	142_L	1.608	0.62
42_F	45_D	1.602	0.61
46_I	145_F	1.585	0.60
78_L	82_T	1.563	0.59
89_R	94_I	1.532	0.58
6_Q	9_T	1.522	0.57
2_T	178_L	1.501	0.56
34_A	45_D	1.489	0.56
78_L	81_A	1.487	0.55
52_Q	58_Y	1.472	0.55
121_I	156_V	1.470	0.55
110_K	113_I	1.469	0.54
57_F	64_N	1.437	0.53
119_R	122_V	1.420	0.52
29_L	84_Q	1.412	0.51
31_V	36_T	1.412	0.51
129_I	155_M	1.378	0.50
7_F	46_I	1.375	0.50
112_L	161_I	1.369	0.49
56_F	76_V	1.355	0.48
164_I	178_L	1.355	0.48
98_V	190_F	1.352	0.48
50_I	112_L	1.334	0.47
26_T	48_F	1.318	0.46
171_L	188_A	1.314	0.46
187_G	190_F	1.313	0.46
23_S	28_R	1.312	0.46
99_I	146_L	1.308	0.46
125_C	129_I	1.305	0.46
29_L	75_A	1.282	0.45
160_P	163_F	1.263	0.44
15_G	85_S	1.261	0.44
11_L	15_G	1.241	0.42
3_L	9_T	1.239	0.42
75_A	80_V	1.233	0.42
29_L	52_Q	1.232	0.42
81_A	85_S	1.231	0.42
27_Y	76_V	1.227	0.42
26_T	30_F	1.220	0.41
28_R	31_V	1.213	0.41
9_T	33_R	1.207	0.41
133_A	137_K	1.200	0.40
46_I	87_C	1.196	0.40
29_L	80_V	1.193	0.40
111_K	115_H	1.179	0.39
141_S	148_L	1.177	0.39
106_Y	123_W	1.168	0.39
38_R	44_H	1.150	0.38
43_I	125_C	1.146	0.38
98_V	159_F	1.134	0.37
48_F	163_F	1.129	0.37
51_M	87_C	1.126	0.37
46_I	157_L	1.121	0.36
5_T	100_Y	1.119	0.36
103_V	146_L	1.112	0.36
49_W	120_P	1.104	0.36
93_K	165_A	1.090	0.35
106_Y	115_H	1.078	0.34
57_F	60_L	1.078	0.34
39_W	55_L	1.076	0.34
5_T	9_T	1.075	0.34
75_A	81_A	1.072	0.34
111_K	145_F	1.057	0.33
117_L	183_Y	1.056	0.33
128_I	132_A	1.050	0.33
124_T	178_L	1.044	0.33
3_L	22_A	1.041	0.33
111_K	146_L	1.033	0.32
46_I	143_I	1.031	0.32
52_Q	95_L	1.031	0.32
112_L	131_L	1.030	0.32
117_L	133_A	1.022	0.32
108_F	177_R	1.021	0.32
159_F	163_F	1.016	0.31
56_F	134_F	1.013	0.31
56_F	185_E	1.011	0.31
96_K	188_A	1.008	0.31
1_M	5_T	1.006	0.31
55_L	110_K	0.997	0.31
161_I	175_K	0.996	0.31
49_W	73_F	0.994	0.30
30_F	42_F	0.992	0.30
34_A	42_F	0.987	0.30
16_M	54_L	0.974	0.30
130_W	137_K	0.974	0.30
87_C	170_K	0.972	0.29
147_L	153_I	0.964	0.29
56_F	104_S	0.963	0.29
12_A	129_I	0.962	0.29
48_F	84_Q	0.960	0.29
29_L	99_I	0.955	0.29
18_L	171_L	0.948	0.28
26_T	81_A	0.943	0.28
132_A	173_P	0.935	0.28
62_H	169_L	0.933	0.28
61_L	65_E	0.930	0.28
172_L	190_F	0.913	0.27
63_V	91_Y	0.912	0.27
71_Y	74_L	0.907	0.27
48_F	52_Q	0.904	0.27
55_L	135_L	0.901	0.26
109_F	116_V	0.894	0.26
24_L	128_I	0.890	0.26
24_L	38_R	0.887	0.26
8_Y	121_I	0.883	0.26
3_L	67_E	0.883	0.26
9_T	60_L	0.882	0.26
70_I	136_F	0.880	0.26
153_I	186_K	0.876	0.25
185_E	190_F	0.870	0.25
166_K	170_K	0.863	0.25
1_M	13_M	0.856	0.25
125_C	134_F	0.855	0.25
27_Y	47_L	0.851	0.24
100_Y	104_S	0.847	0.24
6_Q	60_L	0.845	0.24
20_L	94_I	0.842	0.24
94_I	190_F	0.833	0.24
18_L	87_C	0.832	0.24
7_F	52_Q	0.817	0.23
130_W	134_F	0.815	0.23
2_T	7_F	0.815	0.23
52_Q	91_Y	0.814	0.23
113_I	168_C	0.813	0.23
42_F	52_Q	0.810	0.23
153_I	156_V	0.809	0.23
54_L	105_V	0.804	0.23
67_E	80_V	0.803	0.23
26_T	75_A	0.801	0.23
24_L	31_V	0.801	0.23
75_A	78_L	0.800	0.22
136_F	187_G	0.796	0.22
38_R	55_L	0.788	0.22
116_V	150_L	0.788	0.22
26_T	42_F	0.784	0.22
111_K	179_T	0.783	0.22
107_Q	124_T	0.782	0.22
49_W	60_L	0.780	0.22
67_E	96_K	0.779	0.22
73_F	86_L	0.773	0.22
12_A	91_Y	0.771	0.21
28_R	34_A	0.768	0.21
39_W	59_V	0.764	0.21
16_M	42_F	0.763	0.21
47_L	70_I	0.762	0.21
53_G	61_L	0.761	0.21
68_F	97_F	0.760	0.21
33_R	42_F	0.758	0.21
102_V	149_C	0.755	0.21
121_I	186_K	0.752	0.21
93_K	101_L	0.748	0.21
157_L	177_R	0.740	0.20
15_G	37_A	0.738	0.20
48_F	91_Y	0.738	0.20
61_L	80_V	0.735	0.20
56_F	161_I	0.734	0.20
59_V	67_E	0.732	0.20
81_A	94_I	0.732	0.20
17_G	66_G	0.727	0.20
87_C	128_I	0.725	0.20
72_I	106_Y	0.724	0.20
18_L	61_L	0.713	0.19
55_L	104_S	0.711	0.19
21_G	79_G	0.707	0.19
6_Q	64_N	0.705	0.19
21_G	74_L	0.703	0.19
48_F	152_K	0.703	0.19
63_V	145_F	0.699	0.19
122_V	172_L	0.690	0.19
98_V	116_V	0.689	0.19
128_I	142_L	0.684	0.19
114_Q	145_F	0.679	0.18
114_Q	119_R	0.677	0.18
24_L	36_T	0.676	0.18
125_C	147_L	0.676	0.18
3_L	7_F	0.671	0.18
27_Y	42_F	0.667	0.18
17_G	79_G	0.664	0.18
2_T	81_A	0.660	0.18
75_A	84_Q	0.659	0.18
112_L	187_G	0.650	0.17
90_I	105_V	0.644	0.17
170_K	185_E	0.642	0.17
59_V	187_G	0.641	0.17
30_F	95_L	0.639	0.17
49_W	57_F	0.633	0.17
80_V	88_K	0.630	0.17
31_V	163_F	0.628	0.17
66_G	79_G	0.625	0.17
75_A	96_K	0.625	0.17
123_W	188_A	0.625	0.17
87_C	187_G	0.624	0.17
119_R	123_W	0.623	0.17
12_A	62_H	0.620	0.17
183_Y	188_A	0.615	0.16
68_F	149_C	0.611	0.16
138_K	184_F	0.610	0.16
10_M	82_T	0.608	0.16
9_T	64_N	0.606	0.16
112_L	127_A	0.603	0.16
2_T	111_K	0.603	0.16
19_W	45_D	0.597	0.16
179_T	186_K	0.593	0.16
48_F	58_Y	0.593	0.16
36_T	44_H	0.591	0.16
156_V	160_P	0.590	0.16
151_Y	157_L	0.590	0.16
26_T	63_V	0.590	0.16
43_I	104_S	0.588	0.16
28_R	45_D	0.587	0.16
33_R	41_L	0.584	0.16
32_I	139_T	0.582	0.15
20_L	28_R	0.579	0.15
19_W	130_W	0.578	0.15
100_Y	158_C	0.577	0.15
78_L	86_L	0.575	0.15
51_M	167_Q	0.568	0.15
101_L	128_I	0.567	0.15
46_I	108_F	0.565	0.15
56_F	88_K	0.564	0.15
117_L	138_K	0.563	0.15
23_S	92_I	0.560	0.15
40_L	117_L	0.560	0.15
39_W	57_F	0.559	0.15
4_T	8_Y	0.558	0.15
42_F	173_P	0.556	0.15
21_G	83_Y	0.555	0.15
24_L	80_V	0.552	0.15
106_Y	124_T	0.552	0.15
178_L	183_Y	0.550	0.15
27_Y	44_H	0.550	0.15
179_T	190_F	0.550	0.15
105_V	116_V	0.549	0.15
100_Y	153_I	0.546	0.14
59_V	148_L	0.546	0.14
64_N	120_P	0.540	0.14
52_Q	80_V	0.539	0.14
26_T	88_K	0.532	0.14
54_L	124_T	0.531	0.14
160_P	171_L	0.529	0.14
126_G	135_L	0.528	0.14
81_A	91_Y	0.527	0.14
16_M	56_F	0.525	0.14
30_F	167_Q	0.524	0.14
80_V	84_Q	0.520	0.14
124_T	161_I	0.516	0.14
144_G	148_L	0.516	0.14
11_L	171_L	0.510	0.14
132_A	190_F	0.508	0.14
112_L	128_I	0.507	0.14
85_S	122_V	0.507	0.14
66_G	120_P	0.506	0.13
41_L	45_D	0.500	0.13

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4pndA	3	0.1422	4.3	0.962	Contact Map
2lomA	1	0.1469	4	0.963	Contact Map
2k6oA	1	0.1754	2.5	0.967	Contact Map
1lypA	1	0.1517	2.3	0.967	Contact Map
2a9hA	4	0.4455	2.1	0.968	Contact Map
2fcgF	1	0.0853	1.8	0.969	Contact Map
1rh5B	1	0.1185	1.5	0.97	Contact Map
1orqC	4	0.4502	1.5	0.971	Contact Map
2ih3C	4	0.4455	1.4	0.971	Contact Map
4ogqB	1	0.3318	1.4	0.971	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0069 seconds.