YABO - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YABO - Uncharacterized protein YabO

UniProt:	P37557	Sequences: MRLDKFLKVSRLIKRRTLAKEVADQGRISINGNQAKASSDVKPGDELTVRFGQKLVTVQVNELKDTTKKEEAANMYTILKEEKLGE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	86 (79)
Sequences:	817 (478)
Seq/√Len:	53.8

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
59_Q	77_T	6.592	1.00
30_I	39_S	4.077	1.00
61_N	77_T	3.838	1.00
48_T	57_T	2.664	1.00
35_A	39_S	2.242	1.00
29_S	48_T	2.187	1.00
12_L	58_V	2.148	1.00
24_D	37_A	2.109	1.00
46_E	57_T	1.992	1.00
32_G	46_E	1.696	0.99
47_L	60_V	1.640	0.98
3_L	35_A	1.638	0.98
29_S	50_R	1.592	0.98
68_K	71_E	1.588	0.98
46_E	59_Q	1.581	0.98
31_N	45_D	1.505	0.97
30_I	41_V	1.360	0.95
13_I	22_V	1.257	0.93
20_K	39_S	1.242	0.92
23_A	28_I	1.218	0.91
23_A	37_A	1.202	0.91
71_E	74_N	1.197	0.91
3_L	47_L	1.184	0.90
18_L	55_L	1.172	0.90
41_V	63_L	1.159	0.89
64_K	67_T	1.154	0.89
10_S	75_M	1.152	0.89
60_V	63_L	1.149	0.89
64_K	75_M	1.098	0.87
72_A	76_Y	1.094	0.86
58_V	78_I	1.092	0.86
27_R	51_F	1.086	0.86
48_T	55_L	1.073	0.85
47_L	58_V	1.060	0.85
26_G	34_Q	1.043	0.84
43_P	62_E	1.040	0.83
18_L	21_E	1.020	0.82
6_F	63_L	1.000	0.81
56_V	78_I	0.977	0.79
64_K	71_E	0.972	0.79
50_R	55_L	0.953	0.78
3_L	38_S	0.952	0.78
36_K	51_F	0.948	0.77
44_G	59_Q	0.939	0.77
27_R	52_G	0.936	0.76
37_A	53_Q	0.935	0.76
5_K	9_V	0.923	0.75
25_Q	37_A	0.901	0.74
43_P	63_L	0.883	0.72
27_R	50_R	0.880	0.72
63_L	67_T	0.863	0.70
34_Q	40_D	0.848	0.69
71_E	75_M	0.829	0.67
62_E	71_E	0.807	0.65
29_S	32_G	0.748	0.59
46_E	79_L	0.743	0.59
20_K	42_K	0.736	0.58
62_E	74_N	0.730	0.57
8_K	13_I	0.730	0.57
12_L	56_V	0.725	0.57
49_V	53_Q	0.725	0.57
28_I	49_V	0.724	0.57
43_P	73_A	0.700	0.54
59_Q	79_L	0.695	0.54
23_A	38_S	0.690	0.53
17_T	21_E	0.689	0.53
29_S	74_N	0.686	0.53
10_S	72_A	0.685	0.53
57_T	79_L	0.684	0.52
26_G	47_L	0.684	0.52
8_K	11_R	0.684	0.52
12_L	78_I	0.681	0.52
63_L	68_K	0.678	0.52
50_R	53_Q	0.675	0.52
20_K	36_K	0.674	0.51
10_S	27_R	0.667	0.51
66_T	70_E	0.666	0.51
62_E	75_M	0.659	0.50
12_L	47_L	0.656	0.50
34_Q	55_L	0.648	0.49
25_Q	50_R	0.646	0.48
32_G	73_A	0.637	0.47
22_V	53_Q	0.637	0.47
42_K	79_L	0.623	0.46
48_T	61_N	0.614	0.45
65_D	68_K	0.611	0.45
24_D	52_G	0.604	0.44
66_T	71_E	0.602	0.44
20_K	25_Q	0.588	0.42
22_V	42_K	0.587	0.42
18_L	37_A	0.584	0.42
13_I	19_A	0.582	0.42
22_V	28_I	0.581	0.42
11_R	52_G	0.568	0.40
3_L	41_V	0.567	0.40
11_R	75_M	0.560	0.39
17_T	26_G	0.559	0.39
19_A	26_G	0.557	0.39
46_E	61_N	0.556	0.39
6_F	61_N	0.554	0.39
12_L	25_Q	0.554	0.39
32_G	48_T	0.551	0.39
36_K	39_S	0.544	0.38
8_K	17_T	0.543	0.38
39_S	78_I	0.533	0.37
53_Q	57_T	0.531	0.37
52_G	58_V	0.528	0.36
25_Q	34_Q	0.527	0.36
21_E	38_S	0.524	0.36
7_L	60_V	0.522	0.36
6_F	40_D	0.521	0.36
36_K	63_L	0.517	0.35
39_S	66_T	0.513	0.35
20_K	78_I	0.509	0.34
25_Q	52_G	0.507	0.34
43_P	61_N	0.505	0.34
46_E	77_T	0.503	0.34
18_L	22_V	0.500	0.34

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2k6pA	1	0.9535	99.4	0.603	Contact Map
1dm9A	1	1	99.4	0.607	Contact Map
4bpeD	2	0.8605	98.8	0.694	Contact Map
3j80J	1	0.8837	98.8	0.699	Contact Map
3j7aE	1	0.9186	98.6	0.712	Contact Map
4tp8D	1	1	98.6	0.714	Contact Map
4rb5D	1	1	98.6	0.715	Contact Map
3bbnD	1	1	98.6	0.716	Contact Map
3j38J	1	0.8605	98.6	0.719	Contact Map
4ujpK	1	0.8372	98.5	0.722	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0042 seconds.