SP5T - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

SP5T - Stage V sporulation protein T

UniProt:	P37554	Sequences: MKATGIVRRIDDLGRVVIPKEIRRTLRIREGDPLEIFVDRDGEVILKKYSPISELGDFAKEYADALYDSLGHSVLICDRDVYIAVSGSSKKDYLNKSISEMLERTMDQRSSVLESDAKSVQLVNGIDEDMNSYTVGPIVANGDPIGAVVIFSKDQTMGEVEHKAVETAAGFLARQMEQ	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	178 (177)
Sequences:	526 (319)
Seq/√Len:	24.0

BACSU - SP5T

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
77_C	147_A	5.809	1.00
77_C	82_Y	4.902	1.00
59_A	84_A	3.796	1.00
158_G	161_E	3.274	1.00
70_L	164_A	3.269	1.00
62_Y	168_A	3.255	1.00
16_V	25_T	2.566	0.99
98_I	106_M	2.523	0.99
75_L	82_Y	2.478	0.98
135_V	147_A	2.282	0.97
106_M	144_P	2.256	0.97
109_R	143_D	2.250	0.97
105_T	112_V	2.234	0.97
74_V	150_I	2.233	0.97
136_G	169_A	2.226	0.97
98_I	102_L	2.217	0.97
38_V	99_S	2.082	0.95
38_V	102_L	2.051	0.95
111_S	162_H	1.888	0.92
24_R	29_R	1.858	0.92
31_G	90_K	1.839	0.91
99_S	102_L	1.838	0.91
72_H	157_M	1.724	0.88
114_E	133_Y	1.712	0.88
57_D	69_S	1.580	0.83
116_D	119_S	1.538	0.82
46_L	68_D	1.503	0.80
102_L	135_V	1.487	0.79
10_I	16_V	1.447	0.77
96_K	125_G	1.433	0.77
55_L	176_M	1.428	0.76
160_V	167_T	1.361	0.73
70_L	150_I	1.329	0.71
145_I	175_Q	1.328	0.71
60_K	140_A	1.326	0.71
63_A	168_A	1.321	0.71
163_K	166_E	1.318	0.70
106_M	147_A	1.305	0.70
70_L	106_M	1.301	0.69
51_P	54_E	1.295	0.69
46_L	135_V	1.272	0.68
67_Y	119_S	1.253	0.66
68_D	173_A	1.235	0.65
100_E	110_S	1.216	0.64
148_V	165_V	1.209	0.64
26_L	46_L	1.206	0.63
53_S	95_N	1.203	0.63
34_L	55_L	1.196	0.63
139_V	173_A	1.183	0.62
170_G	174_R	1.182	0.62
74_V	149_V	1.181	0.62
62_Y	66_L	1.179	0.62
44_V	119_S	1.168	0.61
107_D	127_D	1.163	0.60
1_M	4_T	1.163	0.60
46_L	60_K	1.145	0.59
123_V	174_R	1.142	0.59
79_R	107_D	1.133	0.58
82_Y	149_V	1.132	0.58
45_I	64_D	1.130	0.58
47_K	80_D	1.113	0.57
85_V	88_S	1.112	0.57
144_P	173_A	1.109	0.57
57_D	81_V	1.085	0.55
11_D	17_V	1.076	0.54
8_R	17_V	1.076	0.54
14_G	17_V	1.076	0.54
11_D	15_R	1.076	0.54
11_D	14_G	1.076	0.54
8_R	15_R	1.076	0.54
8_R	14_G	1.076	0.54
8_R	13_L	1.076	0.54
8_R	11_D	1.076	0.54
13_L	17_V	1.076	0.54
65_A	130_M	1.076	0.54
3_A	12_D	1.074	0.54
65_A	136_G	1.073	0.54
27_R	55_L	1.068	0.54
40_R	65_A	1.066	0.54
10_I	26_L	1.061	0.53
111_S	136_G	1.048	0.52
2_K	9_R	1.046	0.52
67_Y	95_N	1.045	0.52
168_A	175_Q	1.040	0.52
27_R	32_D	1.038	0.52
145_I	150_I	1.037	0.52
19_P	23_R	1.036	0.52
104_R	108_Q	1.020	0.50
120_V	125_G	0.999	0.49
68_D	174_R	0.996	0.49
95_N	130_M	0.992	0.48
34_L	39_D	0.968	0.47
50_S	80_D	0.964	0.46
67_Y	114_E	0.954	0.46
125_G	128_E	0.938	0.45
93_Y	130_M	0.938	0.45
27_R	90_K	0.935	0.44
54_E	63_A	0.934	0.44
52_I	80_D	0.934	0.44
18_I	137_P	0.932	0.44
38_V	101_M	0.928	0.44
38_V	68_D	0.924	0.44
61_E	153_K	0.922	0.44
58_F	62_Y	0.919	0.43
150_I	165_V	0.911	0.43
113_L	158_G	0.908	0.43
100_E	122_L	0.905	0.42
20_K	23_R	0.903	0.42
26_L	133_Y	0.903	0.42
67_Y	126_I	0.903	0.42
5_G	11_D	0.897	0.42
5_G	15_R	0.897	0.42
5_G	14_G	0.897	0.42
5_G	13_L	0.897	0.42
5_G	8_R	0.897	0.42
5_G	17_V	0.897	0.42
51_P	62_Y	0.895	0.42
3_A	7_V	0.889	0.41
89_S	94_L	0.880	0.41
18_I	45_I	0.879	0.41
13_L	23_R	0.879	0.41
8_R	19_P	0.879	0.41
15_R	19_P	0.879	0.41
8_R	23_R	0.879	0.41
13_L	19_P	0.879	0.41
15_R	23_R	0.879	0.41
14_G	19_P	0.879	0.41
11_D	23_R	0.879	0.41
17_V	23_R	0.879	0.41
14_G	23_R	0.879	0.41
11_D	19_P	0.879	0.41
29_R	32_D	0.877	0.40
113_L	116_D	0.874	0.40
52_I	90_K	0.869	0.40
99_S	137_P	0.866	0.40
64_D	84_A	0.865	0.40
70_L	152_S	0.860	0.39
136_G	150_I	0.851	0.39
140_A	173_A	0.846	0.38
86_S	117_A	0.837	0.38
134_T	165_V	0.833	0.37
32_D	122_L	0.830	0.37
26_L	44_V	0.828	0.37
18_I	44_V	0.828	0.37
31_G	44_V	0.825	0.37
111_S	129_D	0.816	0.36
82_Y	127_D	0.812	0.36
62_Y	175_Q	0.809	0.36
24_R	142_G	0.804	0.36
73_S	88_S	0.799	0.35
53_S	141_N	0.792	0.35
37_F	54_E	0.787	0.34
46_L	157_M	0.768	0.33
83_I	152_S	0.762	0.33
117_A	121_Q	0.762	0.33
65_A	69_S	0.756	0.32
33_P	42_G	0.751	0.32
8_R	20_K	0.750	0.32
11_D	20_K	0.750	0.32
13_L	20_K	0.750	0.32
17_V	20_K	0.750	0.32
14_G	20_K	0.750	0.32
15_R	20_K	0.750	0.32
62_Y	139_V	0.749	0.32
56_G	83_I	0.744	0.32
12_D	30_E	0.742	0.32
82_Y	129_D	0.740	0.31
67_Y	73_S	0.739	0.31
80_D	103_E	0.733	0.31
122_L	156_T	0.732	0.31
89_S	93_Y	0.730	0.31
126_I	133_Y	0.728	0.31
43_E	84_A	0.726	0.31
24_R	49_Y	0.723	0.30
22_I	37_F	0.722	0.30
67_Y	121_Q	0.718	0.30
3_A	42_G	0.715	0.30
121_Q	124_N	0.714	0.30
118_K	155_Q	0.700	0.29
95_N	160_V	0.699	0.29
5_G	19_P	0.699	0.29
5_G	23_R	0.699	0.29
54_E	175_Q	0.687	0.28
38_V	120_V	0.677	0.28
110_S	131_N	0.676	0.28
64_D	69_S	0.673	0.28
76_I	148_V	0.672	0.27
113_L	120_V	0.668	0.27
17_V	21_E	0.665	0.27
11_D	21_E	0.665	0.27
13_L	21_E	0.665	0.27
8_R	21_E	0.665	0.27
15_R	21_E	0.665	0.27
14_G	21_E	0.665	0.27
69_S	77_C	0.663	0.27
93_Y	121_Q	0.656	0.27
124_N	156_T	0.650	0.26
130_M	152_S	0.648	0.26
76_I	120_V	0.647	0.26
68_D	144_P	0.642	0.26
28_I	36_I	0.633	0.25
51_P	176_M	0.629	0.25
160_V	166_E	0.628	0.25
10_I	76_I	0.628	0.25
124_N	127_D	0.627	0.25
7_V	24_R	0.621	0.25
7_V	10_I	0.620	0.25
149_V	152_S	0.618	0.25
139_V	144_P	0.615	0.24
112_V	135_V	0.615	0.24
87_G	176_M	0.613	0.24
121_Q	133_Y	0.612	0.24
147_A	165_V	0.610	0.24
43_E	59_A	0.607	0.24
65_A	111_S	0.605	0.24
46_L	145_I	0.602	0.24
82_Y	174_R	0.597	0.23
73_S	125_G	0.596	0.23
51_P	168_A	0.589	0.23
133_Y	141_N	0.584	0.23
57_D	85_V	0.581	0.23
32_D	154_D	0.579	0.23
94_L	174_R	0.576	0.22
67_Y	170_G	0.574	0.22
3_A	6_I	0.574	0.22
73_S	85_V	0.572	0.22
5_G	20_K	0.570	0.22
95_N	173_A	0.568	0.22
100_E	108_Q	0.561	0.22
97_S	156_T	0.558	0.22
116_D	159_E	0.554	0.21
89_S	112_V	0.553	0.21
87_G	148_V	0.552	0.21
105_T	114_E	0.551	0.21
3_A	16_V	0.547	0.21
26_L	32_D	0.547	0.21
134_T	161_E	0.545	0.21
56_G	127_D	0.544	0.21
51_P	87_G	0.543	0.21
81_V	140_A	0.541	0.21
120_V	124_N	0.536	0.20
74_V	129_D	0.535	0.20
115_S	132_S	0.528	0.20
59_A	172_L	0.527	0.20
104_R	149_V	0.526	0.20
55_L	165_V	0.526	0.20
45_I	175_Q	0.523	0.20
116_D	126_I	0.521	0.20
55_L	167_T	0.521	0.20
114_E	119_S	0.517	0.20
100_E	104_R	0.517	0.20
9_R	24_R	0.516	0.20
12_D	172_L	0.513	0.19
123_V	141_N	0.512	0.19
106_M	132_S	0.511	0.19
62_Y	145_I	0.511	0.19
101_M	121_Q	0.508	0.19
67_Y	166_E	0.508	0.19
18_I	73_S	0.507	0.19
70_L	140_A	0.506	0.19
40_R	145_I	0.505	0.19
97_S	123_V	0.504	0.19
101_M	126_I	0.504	0.19
63_A	91_K	0.502	0.19
40_R	130_M	0.501	0.19
51_P	55_L	0.500	0.19

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2w1tA	2	0.9831	100	0.43	Contact Map
2w1rA	2	0.6573	99.8	0.7	Contact Map
1yfbA	2	0.2865	99.2	0.807	Contact Map
2mrnA	2	0.2865	98.6	0.849	Contact Map
2l66A	2	0.2921	98.6	0.849	Contact Map
3o27A	2	0.2921	98.2	0.864	Contact Map
1mvfD	1	0.2472	97.8	0.88	Contact Map
2glwA	1	0.2584	97.4	0.887	Contact Map
2gx5A	2	0.7697	96.8	0.898	Contact Map
4mn7A	2	0.7303	95.9	0.907	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0066 seconds.