YAAQ - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YAAQ - Uncharacterized protein YaaQ

UniProt:	P37538	Sequences: MKLIVAVVQDQDSNRLLKTLTDHNFRVTKLATTGGFLKSGNTTFMIGVEDIRVNKALSLIKENGQKRDQMIAPVSPMGGNADSYVPYPVEVEVGGATVFVLPVDEFHQF	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	109 (108)
Sequences:	488 (302)
Seq/√Len:	29.1

BACSU - YAAQ

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
5_V	45_M	4.019	1.00
52_R	55_K	3.422	1.00
68_D	90_E	3.384	1.00
4_I	56_A	3.140	1.00
5_V	101_L	2.791	1.00
17_L	44_F	2.725	1.00
57_L	98_V	2.649	1.00
50_D	102_P	2.374	0.99
23_H	55_K	2.176	0.98
54_N	105_E	2.094	0.98
12_D	67_R	2.068	0.97
20_L	25_F	2.057	0.97
25_F	56_A	1.945	0.96
54_N	58_S	1.881	0.95
61_K	65_Q	1.810	0.94
10_D	42_T	1.794	0.94
47_G	103_V	1.711	0.92
9_Q	16_L	1.661	0.91
66_K	92_E	1.655	0.91
47_G	99_F	1.654	0.91
27_V	44_F	1.609	0.90
26_R	108_Q	1.609	0.90
17_L	27_V	1.593	0.89
51_I	55_K	1.569	0.89
99_F	103_V	1.482	0.85
48_V	56_A	1.482	0.85
10_D	40_G	1.472	0.85
21_T	27_V	1.447	0.84
8_V	44_F	1.428	0.83
70_M	103_V	1.427	0.83
5_V	32_T	1.423	0.83
20_L	56_A	1.328	0.78
33_T	42_T	1.317	0.78
16_L	60_I	1.262	0.75
102_P	105_E	1.233	0.73
3_L	104_D	1.219	0.72
50_D	53_V	1.213	0.72
33_T	40_G	1.198	0.71
55_K	58_S	1.195	0.71
48_V	52_R	1.193	0.70
9_Q	72_A	1.191	0.70
41_N	97_T	1.188	0.70
76_P	86_P	1.141	0.67
71_I	76_P	1.126	0.66
77_M	81_A	1.108	0.65
78_G	108_Q	1.082	0.63
14_N	65_Q	1.072	0.62
4_I	100_V	1.042	0.60
26_R	49_E	1.000	0.57
20_L	84_Y	0.993	0.56
10_D	38_K	0.987	0.56
23_H	89_V	0.986	0.55
47_G	100_V	0.980	0.55
29_K	33_T	0.978	0.55
75_S	81_A	0.958	0.53
15_R	100_V	0.952	0.53
16_L	64_G	0.952	0.53
5_V	47_G	0.943	0.52
53_V	56_A	0.936	0.52
15_R	101_L	0.925	0.51
98_V	105_E	0.922	0.51
7_V	98_V	0.922	0.51
76_P	79_G	0.890	0.48
48_V	55_K	0.888	0.48
50_D	104_D	0.887	0.48
19_T	63_N	0.870	0.46
13_S	33_T	0.867	0.46
58_S	92_E	0.860	0.46
11_Q	108_Q	0.860	0.46
57_L	102_P	0.849	0.45
98_V	107_H	0.843	0.44
6_A	97_T	0.832	0.44
58_S	104_D	0.822	0.43
75_S	79_G	0.821	0.43
64_G	93_V	0.809	0.42
58_S	62_E	0.809	0.42
32_T	48_V	0.789	0.40
29_K	93_V	0.778	0.39
39_S	87_Y	0.773	0.39
74_V	83_S	0.768	0.39
1_M	50_D	0.766	0.39
8_V	16_L	0.761	0.38
8_V	66_K	0.758	0.38
44_F	103_V	0.756	0.38
26_R	87_Y	0.753	0.38
11_Q	83_S	0.750	0.37
84_Y	87_Y	0.750	0.37
23_H	51_I	0.746	0.37
19_T	22_D	0.742	0.37
25_F	48_V	0.735	0.36
13_S	17_L	0.715	0.35
54_N	57_L	0.705	0.34
24_N	52_R	0.702	0.34
79_G	82_D	0.702	0.34
20_L	78_G	0.693	0.33
57_L	60_I	0.689	0.33
39_S	68_D	0.688	0.33
7_V	75_S	0.681	0.32
29_K	40_G	0.679	0.32
38_K	67_R	0.676	0.32
45_M	106_F	0.670	0.32
76_P	90_E	0.668	0.32
47_G	101_L	0.660	0.31
36_F	43_T	0.655	0.31
8_V	25_F	0.641	0.30
35_G	43_T	0.640	0.30
37_L	67_R	0.637	0.30
63_N	74_V	0.630	0.29
25_F	44_F	0.629	0.29
3_L	18_K	0.624	0.29
31_A	44_F	0.622	0.29
80_N	85_V	0.622	0.29
37_L	94_G	0.621	0.28
27_V	73_P	0.616	0.28
21_T	44_F	0.613	0.28
7_V	46_I	0.612	0.28
13_S	44_F	0.609	0.28
49_E	52_R	0.604	0.27
24_N	85_V	0.600	0.27
81_A	104_D	0.595	0.27
58_S	107_H	0.592	0.27
96_A	106_F	0.591	0.27
64_G	79_G	0.587	0.26
55_K	62_E	0.586	0.26
74_V	78_G	0.586	0.26
11_Q	61_K	0.586	0.26
7_V	32_T	0.577	0.26
21_T	108_Q	0.576	0.26
100_V	107_H	0.572	0.25
61_K	68_D	0.569	0.25
32_T	66_K	0.563	0.25
15_R	62_E	0.561	0.25
104_D	107_H	0.560	0.25
4_I	20_L	0.560	0.25
25_F	71_I	0.560	0.25
49_E	56_A	0.559	0.25
26_R	52_R	0.558	0.25
79_G	99_F	0.553	0.24
70_M	78_G	0.552	0.24
18_K	64_G	0.551	0.24
74_V	80_N	0.549	0.24
18_K	58_S	0.541	0.24
49_E	62_E	0.538	0.24
21_T	60_I	0.538	0.24
17_L	76_P	0.537	0.23
10_D	64_G	0.537	0.23
46_I	53_V	0.537	0.23
64_G	94_G	0.532	0.23
2_K	61_K	0.532	0.23
11_Q	82_D	0.530	0.23
5_V	26_R	0.522	0.23
38_K	47_G	0.518	0.22
49_E	59_L	0.512	0.22
69_Q	107_H	0.512	0.22
47_G	56_A	0.511	0.22
58_S	61_K	0.510	0.22
73_P	98_V	0.509	0.22
11_Q	21_T	0.507	0.22
13_S	39_S	0.505	0.22
66_K	71_I	0.501	0.21
10_D	72_A	0.500	0.21
37_L	88_P	0.500	0.21

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4rleA	3	1	100	0.081	Contact Map
3m05A	3	0.8899	100	0.293	Contact Map
4rwwA	3	1	100	0.297	Contact Map
4wk1A	3	0.7706	100	0.309	Contact Map
2o66A	5	0.7523	99.4	0.67	Contact Map
4ozjA	3	0.7523	99.4	0.68	Contact Map
3t9zA	3	0.7523	99.4	0.681	Contact Map
1vfjA	3	0.7798	99.3	0.693	Contact Map
1hwuA	6	0.7523	99.3	0.697	Contact Map
3bzqA	3	0.7523	99.3	0.697	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0056 seconds.