YYAC - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YYAC - Uncharacterized protein YyaC

UniProt:	P37521	Sequences: MNRKGGLFSSQERVKQYVSHTDAAAAKQIQTILSSSLRKAAGKPIVVVCIGTDRSTGDSLGPLVGMKLKQMQLTRFHVYGTLSDPVHAVNMKDKINDIHKLHKNPFVIAVDACLGRVKSVGSFQIGDGPLKPGAGVQKDLPEVGDLHINGIVNVSGFMEYFVLQNTRLNLVMNMANVLAEGLSLTDRTEWRQERLNPLQRLTGRI	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	205 (171)
Sequences:	535 (442)
Seq/√Len:	33.8

BACSU - YYAC

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
79_Y	102_H	5.979	1.00
60_L	178_L	5.708	1.00
67_K	176_N	4.137	1.00
83_S	169_N	3.711	1.00
47_V	182_L	3.553	1.00
128_G	147_H	2.898	1.00
70_Q	176_N	2.730	1.00
126_G	147_H	2.696	1.00
44_P	102_H	2.676	1.00
52_T	165_N	2.422	1.00
153_N	166_T	2.344	0.99
95_I	143_V	2.278	0.99
169_N	173_N	2.179	0.99
84_D	94_K	2.132	0.99
102_H	105_P	2.034	0.98
86_V	94_K	2.014	0.98
59_S	66_M	1.988	0.98
156_G	164_Q	1.939	0.98
124_Q	151_I	1.858	0.97
83_S	173_N	1.821	0.96
135_G	170_L	1.812	0.96
18_V	125_I	1.800	0.96
114_L	153_N	1.765	0.96
79_Y	98_I	1.735	0.95
56_T	164_Q	1.714	0.95
159_E	162_V	1.713	0.95
48_V	86_V	1.712	0.95
133_G	138_K	1.693	0.95
83_S	125_I	1.615	0.93
52_T	174_M	1.613	0.93
47_V	108_I	1.574	0.92
53_D	167_R	1.570	0.92
175_A	179_A	1.558	0.92
67_K	172_M	1.545	0.91
106_F	145_D	1.543	0.91
17_Y	21_T	1.537	0.91
125_I	148_I	1.524	0.91
26_A	30_Q	1.467	0.89
46_V	102_H	1.458	0.89
131_K	142_E	1.454	0.89
154_V	162_V	1.446	0.88
184_L	187_R	1.437	0.88
123_F	177_V	1.415	0.87
29_I	181_G	1.378	0.86
56_T	166_T	1.360	0.85
27_K	30_Q	1.343	0.84
56_T	156_G	1.328	0.84
36_S	127_D	1.315	0.83
54_R	164_Q	1.256	0.80
55_S	159_E	1.247	0.80
88_A	140_L	1.241	0.79
95_I	109_A	1.239	0.79
29_I	125_I	1.225	0.78
77_H	102_H	1.212	0.78
46_V	105_P	1.192	0.76
18_V	25_A	1.166	0.75
154_V	157_F	1.164	0.75
94_K	97_D	1.162	0.74
92_K	96_N	1.143	0.73
89_V	161_F	1.133	0.73
153_N	163_L	1.131	0.72
95_I	142_E	1.128	0.72
156_G	159_E	1.125	0.72
136_V	160_Y	1.118	0.72
33_L	148_I	1.108	0.71
46_V	79_Y	1.099	0.70
114_L	166_T	1.095	0.70
47_V	110_V	1.086	0.69
153_N	164_Q	1.081	0.69
125_I	181_G	1.081	0.69
148_I	178_L	1.069	0.68
160_Y	181_G	1.054	0.67
134_A	158_M	1.052	0.67
156_G	162_V	1.036	0.66
28_Q	36_S	1.031	0.65
29_I	173_N	1.031	0.65
98_I	102_H	1.031	0.65
116_R	147_H	1.021	0.64
25_A	78_V	1.003	0.63
55_S	160_Y	1.002	0.63
25_A	181_G	0.993	0.62
44_P	123_F	0.988	0.62
124_Q	135_G	0.983	0.61
159_E	167_R	0.978	0.61
135_G	154_V	0.962	0.60
18_V	145_D	0.935	0.58
134_A	159_E	0.930	0.57
56_T	171_V	0.929	0.57
55_S	164_Q	0.918	0.56
55_S	158_M	0.918	0.56
112_A	136_V	0.917	0.56
90_N	138_K	0.916	0.56
56_T	149_N	0.906	0.55
89_V	181_G	0.901	0.55
19_S	66_M	0.895	0.54
17_Y	119_S	0.894	0.54
23_A	29_I	0.892	0.54
117_V	120_V	0.885	0.53
53_D	63_L	0.879	0.53
123_F	174_M	0.877	0.53
71_M	183_S	0.876	0.53
87_H	167_R	0.869	0.52
68_L	129_P	0.866	0.52
43_K	125_I	0.861	0.51
78_V	125_I	0.858	0.51
75_R	110_V	0.852	0.51
21_T	118_K	0.848	0.50
52_T	134_A	0.846	0.50
17_Y	20_H	0.837	0.49
104_N	180_E	0.836	0.49
25_A	135_G	0.834	0.49
75_R	109_A	0.829	0.49
39_K	127_D	0.828	0.49
44_P	77_H	0.822	0.48
48_V	143_V	0.819	0.48
157_F	162_V	0.798	0.46
59_S	104_N	0.794	0.46
137_Q	147_H	0.792	0.46
103_K	107_V	0.792	0.46
120_V	154_V	0.784	0.45
154_V	159_E	0.783	0.45
52_T	66_M	0.777	0.44
152_V	163_L	0.765	0.43
85_P	168_L	0.764	0.43
64_V	178_L	0.757	0.43
96_N	108_I	0.757	0.43
156_G	163_L	0.756	0.43
122_S	151_I	0.756	0.43
45_I	69_K	0.754	0.42
114_L	164_Q	0.754	0.42
48_V	130_L	0.753	0.42
153_N	167_R	0.751	0.42
57_G	168_L	0.751	0.42
56_T	153_N	0.742	0.41
66_M	116_R	0.741	0.41
159_E	164_Q	0.740	0.41
43_K	145_D	0.739	0.41
87_H	133_G	0.736	0.41
86_V	107_V	0.721	0.40
25_A	125_I	0.718	0.39
133_G	140_L	0.716	0.39
67_K	71_M	0.713	0.39
84_D	139_D	0.710	0.39
48_V	113_C	0.705	0.38
100_K	182_L	0.703	0.38
20_H	174_M	0.703	0.38
17_Y	66_M	0.701	0.38
96_N	170_L	0.701	0.38
99_H	104_N	0.700	0.38
154_V	171_V	0.700	0.38
48_V	95_I	0.698	0.38
113_C	119_S	0.695	0.38
158_M	162_V	0.691	0.37
81_T	85_P	0.689	0.37
47_V	183_S	0.689	0.37
88_A	112_A	0.686	0.37
20_H	66_M	0.683	0.37
54_R	168_L	0.678	0.36
155_S	164_Q	0.677	0.36
45_I	143_V	0.676	0.36
56_T	162_V	0.674	0.36
53_D	164_Q	0.673	0.36
48_V	98_I	0.670	0.36
61_G	115_G	0.667	0.35
158_M	174_M	0.666	0.35
36_S	146_L	0.662	0.35
87_H	138_K	0.659	0.35
64_V	72_Q	0.653	0.34
71_M	76_F	0.653	0.34
22_D	123_F	0.650	0.34
137_Q	149_N	0.647	0.34
138_K	167_R	0.642	0.34
155_S	159_E	0.640	0.33
29_I	185_T	0.639	0.33
26_A	177_V	0.639	0.33
56_T	134_A	0.636	0.33
83_S	185_T	0.635	0.33
43_K	148_I	0.634	0.33
66_M	75_R	0.632	0.33
131_K	139_D	0.630	0.33
100_K	179_A	0.630	0.33
35_S	123_F	0.625	0.32
67_K	75_R	0.623	0.32
46_V	98_I	0.618	0.32
53_D	112_A	0.616	0.32
38_R	106_F	0.614	0.31
86_V	160_Y	0.613	0.31
132_P	138_K	0.611	0.31
77_H	98_I	0.610	0.31
122_S	126_G	0.610	0.31
20_H	169_N	0.610	0.31
81_T	113_C	0.610	0.31
106_F	146_L	0.608	0.31
164_Q	168_L	0.608	0.31
73_L	182_L	0.608	0.31
113_C	149_N	0.607	0.31
38_R	180_E	0.606	0.31
40_A	103_K	0.604	0.31
68_L	174_M	0.601	0.31
116_R	142_E	0.600	0.30
163_L	171_V	0.598	0.30
93_D	96_N	0.598	0.30
78_V	152_V	0.595	0.30
138_K	165_N	0.594	0.30
25_A	177_V	0.590	0.30
158_M	171_V	0.588	0.30
50_I	63_L	0.586	0.29
64_V	176_N	0.583	0.29
119_S	122_S	0.583	0.29
134_A	157_F	0.568	0.28
89_V	183_S	0.568	0.28
118_K	182_L	0.567	0.28
97_D	169_N	0.567	0.28
87_H	90_N	0.564	0.28
69_K	74_T	0.562	0.28
96_N	182_L	0.560	0.28
155_S	185_T	0.558	0.28
29_I	177_V	0.557	0.27
21_T	173_N	0.556	0.27
38_R	176_N	0.555	0.27
35_S	145_D	0.554	0.27
53_D	87_H	0.554	0.27
45_I	186_D	0.548	0.27
73_L	81_T	0.547	0.27
29_I	123_F	0.547	0.27
140_L	150_G	0.546	0.27
92_K	142_E	0.544	0.27
69_K	97_D	0.543	0.27
78_V	118_K	0.542	0.26
27_K	184_L	0.542	0.26
113_C	162_V	0.539	0.26
75_R	186_D	0.537	0.26
64_V	179_A	0.534	0.26
140_L	143_V	0.532	0.26
54_R	165_N	0.528	0.26
30_Q	181_G	0.526	0.25
34_S	185_T	0.525	0.25
54_R	138_K	0.525	0.25
126_G	185_T	0.525	0.25
35_S	76_F	0.524	0.25
86_V	133_G	0.523	0.25
41_A	99_H	0.521	0.25
52_T	154_V	0.517	0.25
19_S	22_D	0.517	0.25
23_A	137_Q	0.513	0.25
134_A	156_G	0.512	0.25
23_A	27_K	0.511	0.24
57_G	61_G	0.511	0.24
132_P	140_L	0.511	0.24
113_C	124_Q	0.510	0.24
160_Y	165_N	0.506	0.24
100_K	180_E	0.506	0.24
39_K	42_G	0.503	0.24
49_C	121_G	0.501	0.24
23_A	97_D	0.500	0.24
57_G	166_T	0.500	0.24

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1c8bA	3	0.922	100	0.552	Contact Map
1cfzA	1	0.6439	76.9	0.944	Contact Map
2e85A	2	0.6829	69	0.947	Contact Map
3pu6A	1	0.6244	60.5	0.95	Contact Map
2h54A	1	0.5171	59	0.95	Contact Map
4gicA	2	0.7415	42.7	0.955	Contact Map
1pyoA	2	0.5073	30.1	0.958	Contact Map
2fp3A	1	0.8	30	0.958	Contact Map
3p45A	3	0.439	29.6	0.959	Contact Map
8abpA	1	0.8927	27.9	0.959	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0068 seconds.