YYAH - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YYAH - Uncharacterized protein YyaH

UniProt:	P37516	Sequences: MQIEHTAVWVNDLERMKSFYESYFNGEANDLYHNEKKDFKSYFITFDSGARLEIMKKGNVTDPPSQTMTGWAHIAFSVGSREKVDELTDRLKADGFAVVNGPRTTGDGYYESVIEDDEGNLIEITI	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	126 (125)
Sequences:	469 (343)
Seq/√Len:	30.7

BACSU - YYAH

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
26_G	44_I	4.562	1.00
88_T	112_S	4.411	1.00
23_Y	94_D	4.142	1.00
10_V	118_E	3.774	1.00
81_R	104_T	3.641	1.00
78_V	124_I	3.092	1.00
85_D	110_Y	2.823	1.00
31_L	40_K	2.510	0.99
92_K	101_G	2.338	0.99
83_K	86_E	2.167	0.98
77_S	125_T	2.148	0.98
115_E	121_L	2.087	0.98
4_E	51_R	2.082	0.98
40_K	56_K	2.034	0.98
89_D	93_A	1.967	0.97
116_D	120_N	1.950	0.97
20_Y	116_D	1.917	0.96
18_S	21_E	1.917	0.96
20_Y	117_D	1.839	0.95
17_K	28_A	1.818	0.95
89_D	92_K	1.732	0.94
90_R	94_D	1.715	0.93
56_K	60_V	1.715	0.93
11_N	62_D	1.683	0.93
12_D	15_R	1.641	0.92
16_M	118_E	1.601	0.91
92_K	98_V	1.567	0.90
12_D	118_E	1.540	0.89
46_F	52_L	1.535	0.89
87_L	112_S	1.456	0.86
51_R	109_Y	1.377	0.83
26_G	76_F	1.370	0.82
6_T	74_I	1.341	0.81
9_W	20_Y	1.297	0.79
91_L	112_S	1.259	0.77
10_V	16_M	1.242	0.76
17_K	42_Y	1.227	0.75
7_A	29_N	1.225	0.75
22_S	94_D	1.223	0.75
88_T	91_L	1.217	0.74
72_A	116_D	1.204	0.73
43_F	75_A	1.198	0.73
16_M	20_Y	1.194	0.73
98_V	101_G	1.180	0.72
85_D	104_T	1.141	0.69
38_D	58_G	1.099	0.66
25_N	47_D	1.093	0.66
57_K	121_L	1.084	0.65
61_T	66_Q	1.078	0.65
23_Y	96_F	1.069	0.64
2_Q	48_S	1.069	0.64
57_K	67_T	1.061	0.63
4_E	75_A	1.054	0.63
2_Q	15_R	1.053	0.63
87_L	91_L	1.039	0.62
10_V	13_L	1.037	0.62
67_T	121_L	1.035	0.62
82_E	86_E	1.025	0.61
20_Y	113_V	1.024	0.61
81_R	85_D	1.014	0.60
11_N	69_T	1.010	0.60
9_W	37_K	0.973	0.57
71_W	74_I	0.956	0.55
30_D	83_K	0.933	0.54
83_K	90_R	0.926	0.53
16_M	117_D	0.913	0.52
115_E	119_G	0.907	0.51
15_R	118_E	0.903	0.51
24_F	117_D	0.903	0.51
4_E	49_G	0.857	0.47
62_D	82_E	0.839	0.46
24_F	74_I	0.832	0.45
89_D	101_G	0.822	0.45
105_T	125_T	0.810	0.44
39_F	75_A	0.807	0.43
109_Y	118_E	0.803	0.43
61_T	72_A	0.797	0.43
16_M	54_I	0.791	0.42
77_S	80_S	0.786	0.42
9_W	116_D	0.782	0.41
100_N	113_V	0.781	0.41
98_V	124_I	0.780	0.41
9_W	60_V	0.780	0.41
97_A	115_E	0.771	0.41
8_V	71_W	0.767	0.40
99_V	115_E	0.760	0.40
80_S	83_K	0.750	0.39
37_K	100_N	0.746	0.39
33_H	40_K	0.743	0.38
86_E	124_I	0.739	0.38
9_W	113_V	0.735	0.38
4_E	109_Y	0.729	0.37
14_E	42_Y	0.725	0.37
17_K	92_K	0.715	0.36
52_L	114_I	0.714	0.36
100_N	121_L	0.714	0.36
18_S	22_S	0.703	0.35
3_I	6_T	0.697	0.35
61_T	65_S	0.697	0.35
56_K	78_V	0.697	0.35
32_Y	106_G	0.694	0.35
91_L	96_F	0.692	0.35
20_Y	34_N	0.691	0.35
24_F	31_L	0.690	0.35
20_Y	37_K	0.685	0.34
8_V	72_A	0.679	0.34
54_I	100_N	0.678	0.34
16_M	116_D	0.675	0.33
21_E	44_I	0.672	0.33
41_S	57_K	0.671	0.33
28_A	52_L	0.670	0.33
61_T	67_T	0.661	0.32
9_W	39_F	0.660	0.32
19_F	114_I	0.656	0.32
9_W	41_S	0.655	0.32
24_F	115_E	0.654	0.32
9_W	121_L	0.653	0.32
20_Y	120_N	0.652	0.32
33_H	101_G	0.652	0.32
22_S	47_D	0.650	0.32
9_W	72_A	0.650	0.32
4_E	50_A	0.648	0.32
33_H	37_K	0.645	0.31
34_N	46_F	0.645	0.31
86_E	90_R	0.645	0.31
99_V	121_L	0.645	0.31
113_V	116_D	0.642	0.31
27_E	47_D	0.640	0.31
8_V	93_A	0.637	0.31
9_W	117_D	0.634	0.31
39_F	57_K	0.629	0.30
42_Y	54_I	0.618	0.29
56_K	74_I	0.617	0.29
84_V	103_R	0.613	0.29
23_Y	91_L	0.611	0.29
22_S	65_S	0.610	0.29
29_N	87_L	0.607	0.29
82_E	104_T	0.603	0.29
7_A	88_T	0.599	0.28
37_K	57_K	0.597	0.28
5_H	107_D	0.594	0.28
8_V	74_I	0.593	0.28
64_P	76_F	0.590	0.28
72_A	120_N	0.590	0.28
34_N	37_K	0.588	0.28
91_L	94_D	0.585	0.27
6_T	104_T	0.583	0.27
63_P	86_E	0.579	0.27
27_E	82_E	0.578	0.27
35_E	56_K	0.578	0.27
26_G	40_K	0.577	0.27
68_M	121_L	0.576	0.27
21_E	28_A	0.576	0.27
58_G	86_E	0.562	0.26
19_F	113_V	0.559	0.26
29_N	76_F	0.557	0.26
72_A	122_I	0.557	0.26
5_H	84_V	0.557	0.26
105_T	110_Y	0.555	0.25
4_E	39_F	0.553	0.25
9_W	56_K	0.552	0.25
39_F	43_F	0.549	0.25
22_S	62_D	0.543	0.25
27_E	86_E	0.543	0.25
24_F	30_D	0.534	0.24
67_T	81_R	0.532	0.24
22_S	90_R	0.531	0.24
63_P	74_I	0.529	0.24
76_F	101_G	0.528	0.24
38_D	68_M	0.527	0.24
24_F	63_P	0.524	0.24
56_K	118_E	0.523	0.24
75_A	109_Y	0.516	0.23
84_V	107_D	0.516	0.23
103_R	107_D	0.515	0.23
47_D	81_R	0.514	0.23
36_K	60_V	0.513	0.23
77_S	105_T	0.513	0.23
44_I	74_I	0.513	0.23
101_G	110_Y	0.512	0.23
37_K	58_G	0.510	0.23
57_K	69_T	0.508	0.23
19_F	112_S	0.505	0.23
20_Y	31_L	0.505	0.23
8_V	31_L	0.504	0.22
87_L	124_I	0.502	0.22
55_M	115_E	0.502	0.22
56_K	125_T	0.500	0.22

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3e5dA	2	1	99.9	0.628	Contact Map
2rbbA	2	0.9444	99.8	0.683	Contact Map
1xqaA	2	0.881	99.8	0.696	Contact Map
3kolA	2	0.9683	99.8	0.697	Contact Map
4mtsA	2	0.9603	99.8	0.7	Contact Map
1f9zA	2	0.9603	99.8	0.7	Contact Map
3w0tA	2	0.9683	99.7	0.705	Contact Map
1ss4A	4	0.9683	99.7	0.714	Contact Map
3rheA	2	0.8889	99.7	0.714	Contact Map
2rk0A	4	0.9603	99.7	0.715	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0052 seconds.