YYAN - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YYAN - Uncharacterized HTH-type transcriptional regulator YyaN

UniProt:	P37510	Sequences: MLLYSISKAAEKTSISSYTLRYYEKIGLLPPPKRKNSGRRFYTETDIQFMLFLKSLKETGMSLEDINEFVKDGCILEKINSDVKSAQLSPSINKRIEILTKHLEKMEIKKRELEEVISTTKGKLDTYYSILKEEVENK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	138 (113)
Sequences:	12836 (8986)
Seq/√Len:	845.4

ECOLI - ZNTR CUER SOXR BLUR MLRA
BACSU - YYAN YFMP ADHR MTA BLTR CUER YDFL BMRR GLNR TNRA

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
43_T	46_D	3.965	1.00
18_Y	25_K	3.121	1.00
100_T	110_K	3.032	1.00
22_Y	26_I	2.965	1.00
17_S	21_R	2.502	1.00
96_I	100_T	2.305	1.00
103_L	107_E	2.131	1.00
35_K	41_F	2.126	1.00
57_K	63_L	2.013	1.00
54_K	57_K	1.985	1.00
7_S	11_E	1.931	1.00
26_I	67_N	1.849	1.00
95_R	98_I	1.845	1.00
9_A	50_M	1.796	1.00
9_A	47_I	1.784	1.00
93_N	117_I	1.761	1.00
49_F	70_V	1.729	1.00
89_S	93_N	1.700	1.00
89_S	107_E	1.693	1.00
4_Y	41_F	1.692	1.00
88_L	91_S	1.679	1.00
62_S	65_D	1.633	1.00
110_K	114_E	1.538	1.00
8_K	11_E	1.497	1.00
107_E	110_K	1.456	1.00
5_S	41_F	1.453	1.00
6_I	21_R	1.448	1.00
93_N	103_L	1.412	1.00
28_L	53_L	1.401	1.00
5_S	8_K	1.395	1.00
99_L	103_L	1.392	1.00
102_H	105_K	1.296	1.00
98_I	102_H	1.295	1.00
13_T	50_M	1.294	1.00
100_T	103_L	1.294	1.00
9_A	46_D	1.288	1.00
24_E	30_P	1.265	1.00
101_K	105_K	1.194	1.00
96_I	114_E	1.194	1.00
65_D	68_E	1.187	1.00
67_N	71_K	1.171	1.00
96_I	99_L	1.157	1.00
87_Q	90_P	1.157	1.00
10_A	17_S	1.142	1.00
97_E	100_T	1.137	1.00
16_S	19_T	1.125	1.00
23_Y	50_M	1.105	1.00
33_K	43_T	1.101	1.00
54_K	58_E	1.086	1.00
104_E	107_E	1.085	1.00
53_L	66_I	1.083	1.00
20_L	42_Y	1.079	1.00
26_I	64_E	1.065	1.00
33_K	41_F	1.060	1.00
12_K	47_I	1.060	1.00
32_P	46_D	1.040	1.00
5_S	39_R	1.037	1.00
13_T	47_I	1.030	1.00
93_N	97_E	1.025	1.00
19_T	22_Y	1.004	1.00
97_E	101_K	0.982	1.00
20_L	50_M	0.968	1.00
24_E	29_L	0.966	1.00
22_Y	63_L	0.948	1.00
29_L	53_L	0.948	1.00
8_K	12_K	0.947	1.00
92_I	117_I	0.946	1.00
93_N	96_I	0.944	1.00
61_M	69_F	0.918	1.00
109_K	112_E	0.914	1.00
98_I	101_K	0.901	1.00
4_Y	12_K	0.900	1.00
90_P	94_K	0.887	1.00
64_E	67_N	0.872	1.00
85_S	88_L	0.870	1.00
104_E	108_I	0.864	1.00
89_S	103_L	0.864	1.00
13_T	20_L	0.842	1.00
47_I	51_L	0.840	1.00
4_Y	44_E	0.833	1.00
101_K	104_E	0.832	1.00
44_E	48_Q	0.825	1.00
49_F	77_E	0.821	1.00
52_F	56_L	0.816	1.00
29_L	46_D	0.806	1.00
12_K	51_L	0.792	1.00
6_I	10_A	0.787	1.00
94_K	97_E	0.787	1.00
12_K	44_E	0.779	1.00
50_M	57_K	0.778	1.00
94_K	98_I	0.777	1.00
34_R	37_S	0.773	1.00
33_K	46_D	0.769	1.00
86_A	110_K	0.758	1.00
20_L	24_E	0.757	1.00
108_I	112_E	0.756	1.00
80_N	83_V	0.754	1.00
10_A	20_L	0.745	1.00
93_N	107_E	0.744	1.00
115_E	119_T	0.744	1.00
91_S	94_K	0.740	1.00
48_Q	51_L	0.739	1.00
106_M	110_K	0.726	1.00
51_L	55_S	0.724	1.00
35_K	39_R	0.720	1.00
15_I	50_M	0.718	1.00
88_L	92_I	0.711	1.00
100_T	114_E	0.706	1.00
68_E	71_K	0.700	1.00
7_S	17_S	0.699	1.00
31_P	34_R	0.698	1.00
27_G	30_P	0.698	1.00
19_T	57_K	0.697	1.00
100_T	104_E	0.695	1.00
114_E	118_S	0.687	1.00
15_I	54_K	0.678	1.00
58_E	105_K	0.672	1.00
103_L	110_K	0.662	1.00
65_D	95_R	0.658	1.00
115_E	118_S	0.657	1.00
16_S	22_Y	0.650	1.00
24_E	31_P	0.638	1.00
60_G	102_H	0.635	1.00
56_L	61_M	0.633	1.00
60_G	95_R	0.632	1.00
37_S	41_F	0.631	1.00
102_H	109_K	0.627	1.00
107_E	111_R	0.623	1.00
9_A	29_L	0.619	1.00
95_R	102_H	0.618	1.00
24_E	42_Y	0.610	1.00
24_E	32_P	0.610	1.00
57_K	62_S	0.607	1.00
90_P	93_N	0.607	1.00
88_L	95_R	0.606	1.00
86_A	89_S	0.604	1.00
84_K	87_Q	0.601	1.00
6_I	17_S	0.601	1.00
22_Y	25_K	0.601	1.00
82_D	86_A	0.600	1.00
26_I	63_L	0.599	1.00
86_A	114_E	0.599	1.00
15_I	19_T	0.591	1.00
9_A	13_T	0.590	1.00
116_V	119_T	0.584	1.00
58_E	102_H	0.583	1.00
111_R	115_E	0.580	1.00
19_T	63_L	0.577	1.00
112_E	115_E	0.574	1.00
63_L	66_I	0.573	1.00
18_Y	52_F	0.568	1.00
88_L	102_H	0.565	1.00
51_L	54_K	0.562	1.00
13_T	17_S	0.562	1.00
91_S	95_R	0.558	1.00
18_Y	22_Y	0.555	1.00
46_D	49_F	0.553	1.00
96_I	103_L	0.545	1.00
96_I	110_K	0.543	1.00
112_E	116_V	0.543	1.00
45_T	48_Q	0.538	1.00
96_I	117_I	0.536	1.00
87_Q	91_S	0.531	1.00
35_K	38_G	0.529	1.00
81_S	85_S	0.527	1.00
102_H	106_M	0.517	1.00
4_Y	47_I	0.514	1.00
89_S	92_I	0.513	1.00
95_R	99_L	0.510	1.00
84_K	88_L	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3qaoA	2	0.942	99.9	0.223	Contact Map
3gp4A	4	0.9275	99.9	0.224	Contact Map
3hh0A	4	0.971	99.9	0.233	Contact Map
3gpvA	2	0.8406	99.9	0.246	Contact Map
2vz4A	2	0.7246	99.9	0.275	Contact Map
2dg6A	2	0.8768	99.9	0.277	Contact Map
1q06A	2	0.8986	99.9	0.277	Contact Map
1r8dA	2	0.7899	99.9	0.278	Contact Map
4ua1A	2	0.9058	99.9	0.295	Contact Map
2zhgA	2	0.8333	99.9	0.296	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0062 seconds.