YYAO - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YYAO - Uncharacterized protein YyaO

UniProt:	P37509	Sequences: MPNKSKPNRLIAEKSPYLLQHAHNPVDWFPWGEEAFAKAKRENKPVLVSIGYSTTCHWWPGIIKSCGTPLKDNRSHFKR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	79 (67)
Sequences:	1324 (422)
Seq/√Len:	51.5

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
38_K	42_E	3.252	1.00
13_E	30_P	3.138	1.00
32_G	35_A	2.704	1.00
9_R	29_F	2.471	1.00
37_A	41_R	2.339	1.00
24_N	63_I	2.249	1.00
29_F	38_K	2.185	1.00
70_L	74_R	2.157	1.00
36_F	46_V	2.039	1.00
7_P	23_H	1.981	1.00
29_F	32_G	1.749	0.99
11_I	23_H	1.614	0.98
24_N	68_T	1.600	0.98
21_H	52_Y	1.547	0.97
64_K	68_T	1.534	0.97
38_K	41_R	1.428	0.96
9_R	27_D	1.398	0.95
33_E	37_A	1.339	0.94
9_R	34_E	1.326	0.94
14_K	47_L	1.323	0.94
14_K	19_L	1.210	0.90
16_P	19_L	1.182	0.89
7_P	11_I	1.170	0.89
52_Y	55_T	1.145	0.88
69_P	72_D	1.109	0.86
19_L	22_A	1.108	0.86
16_P	55_T	1.106	0.86
66_C	72_D	1.091	0.85
16_P	31_W	1.068	0.84
7_P	27_D	1.041	0.82
21_H	55_T	1.020	0.81
29_F	35_A	1.011	0.80
49_S	52_Y	0.988	0.79
9_R	32_G	0.985	0.78
9_R	35_A	0.980	0.78
36_F	55_T	0.977	0.78
20_Q	60_P	0.959	0.76
45_P	63_I	0.931	0.74
52_Y	67_G	0.904	0.72
49_S	67_G	0.893	0.71
63_I	67_G	0.886	0.71
21_H	49_S	0.884	0.70
14_K	55_T	0.880	0.70
49_S	63_I	0.868	0.69
21_H	24_N	0.860	0.68
21_H	67_G	0.851	0.67
20_Q	53_S	0.848	0.67
12_A	37_A	0.837	0.66
35_A	48_V	0.830	0.66
27_D	38_K	0.827	0.65
20_Q	64_K	0.818	0.64
60_P	66_C	0.807	0.63
11_I	22_A	0.791	0.62
37_A	40_K	0.784	0.61
24_N	53_S	0.732	0.56
11_I	27_D	0.727	0.55
43_N	64_K	0.721	0.55
40_K	43_N	0.720	0.55
71_K	74_R	0.706	0.53
37_A	74_R	0.698	0.52
11_I	19_L	0.686	0.51
47_L	55_T	0.681	0.51
24_N	52_Y	0.676	0.50
41_R	74_R	0.671	0.50
24_N	50_I	0.665	0.49
52_Y	56_C	0.660	0.48
35_A	38_K	0.656	0.48
20_Q	68_T	0.655	0.48
18_L	30_P	0.655	0.48
55_T	64_K	0.649	0.47
55_T	66_C	0.642	0.46
29_F	36_F	0.633	0.46
10_L	18_L	0.625	0.45
42_E	45_P	0.625	0.45
12_A	40_K	0.622	0.44
9_R	30_P	0.618	0.44
17_Y	50_I	0.606	0.43
52_Y	63_I	0.606	0.43
49_S	55_T	0.602	0.42
22_A	49_S	0.592	0.41
53_S	67_G	0.575	0.40
16_P	24_N	0.575	0.40
25_P	68_T	0.572	0.39
51_G	58_W	0.567	0.39
59_W	62_I	0.563	0.38
21_H	53_S	0.561	0.38
62_I	73_N	0.557	0.38
52_Y	57_H	0.556	0.38
8_N	31_W	0.554	0.38
47_L	66_C	0.551	0.37
21_H	56_C	0.540	0.36
13_E	19_L	0.535	0.36
40_K	50_I	0.533	0.36
17_Y	21_H	0.533	0.36
28_W	51_G	0.527	0.35
26_V	66_C	0.524	0.35
12_A	41_R	0.521	0.34
23_H	63_I	0.507	0.33
7_P	33_E	0.503	0.33
29_F	72_D	0.500	0.32

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3iraA	1	0.9241	99.1	0.704	Contact Map
2ec4A	1	0.9241	98.3	0.774	Contact Map
2dlxA	1	0.8987	96.3	0.84	Contact Map
3ph9A	1	0.8101	95.5	0.851	Contact Map
2lstA	1	0.6709	95.2	0.853	Contact Map
2ju5A	1	0.8987	94.9	0.856	Contact Map
3fk8A	1	0.7722	93.6	0.865	Contact Map
3f9uA	2	0.7089	93.2	0.867	Contact Map
1oazA	1	0.5949	93	0.868	Contact Map
2kucA	1	0.7215	92.2	0.871	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0047 seconds.