YYAQ - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YYAQ - Uncharacterized protein YyaQ

UniProt:	P37507	Sequences: MLTREDIFKHVKEKYGTSPDYPWEKYPNYASLRHTSNKKWYGLIMNVLPEKLGLDGHGEIDILNLKCPPEISDRLRNGENILPGYHMDKEHWISIVLERTDPEGEIYNLIEQSFHLTK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	118 (114)
Sequences:	409 (333)
Seq/√Len:	31.2

BACSU - YYAQ

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
17_T	41_Y	7.478	1.00
11_V	32_L	4.266	1.00
34_H	117_T	3.826	1.00
26_Y	29_Y	3.345	1.00
21_Y	30_A	3.057	1.00
8_F	32_L	2.850	1.00
15_Y	111_E	2.532	1.00
10_H	111_E	2.470	0.99
42_G	63_L	2.192	0.99
12_K	18_S	2.116	0.98
78_G	105_E	2.080	0.98
73_D	90_E	2.044	0.98
64_N	94_S	1.993	0.97
7_I	110_I	1.831	0.96
77_N	80_N	1.777	0.95
47_V	82_L	1.730	0.94
8_F	11_V	1.600	0.91
8_F	44_I	1.588	0.91
4_R	61_D	1.575	0.90
11_V	41_Y	1.563	0.90
81_I	109_L	1.515	0.89
49_P	56_G	1.498	0.88
31_S	43_L	1.455	0.87
84_G	89_K	1.453	0.86
22_P	43_L	1.377	0.83
23_W	29_Y	1.325	0.81
31_S	84_G	1.315	0.80
67_C	72_S	1.304	0.80
67_C	112_Q	1.293	0.79
13_E	110_I	1.246	0.77
88_D	91_H	1.244	0.76
106_I	110_I	1.239	0.76
6_D	103_E	1.238	0.76
65_L	93_I	1.215	0.75
98_E	101_D	1.203	0.74
62_I	84_G	1.187	0.73
23_W	43_L	1.186	0.73
7_I	63_L	1.183	0.73
19_P	30_A	1.167	0.72
11_V	42_G	1.141	0.70
25_K	29_Y	1.127	0.69
52_L	82_L	1.101	0.67
19_P	32_L	1.082	0.66
65_L	95_I	1.082	0.66
63_L	94_S	1.054	0.64
108_N	111_E	1.047	0.63
69_P	91_H	1.033	0.62
29_Y	45_M	1.020	0.61
20_D	23_W	1.018	0.61
16_G	106_I	1.012	0.60
55_D	106_I	1.011	0.60
67_C	93_I	0.981	0.58
29_Y	46_N	0.978	0.58
48_L	84_G	0.963	0.57
76_R	90_E	0.959	0.56
34_H	114_F	0.945	0.55
8_F	51_K	0.945	0.55
49_P	58_G	0.938	0.55
49_P	60_I	0.931	0.54
32_L	66_K	0.929	0.54
22_P	64_N	0.915	0.53
69_P	116_L	0.904	0.52
101_D	105_E	0.899	0.51
64_N	84_G	0.898	0.51
6_D	9_K	0.881	0.50
10_H	94_S	0.874	0.49
72_S	76_R	0.872	0.49
18_S	74_R	0.855	0.48
7_I	83_P	0.855	0.48
103_E	107_Y	0.840	0.47
23_W	47_V	0.838	0.46
81_I	93_I	0.836	0.46
10_H	14_K	0.836	0.46
48_L	51_K	0.816	0.45
98_E	104_G	0.812	0.44
22_P	27_P	0.811	0.44
25_K	51_K	0.809	0.44
18_S	52_L	0.796	0.43
8_F	21_Y	0.796	0.43
83_P	110_I	0.792	0.43
71_I	112_Q	0.787	0.42
53_G	56_G	0.784	0.42
9_K	13_E	0.781	0.42
52_L	116_L	0.772	0.41
57_H	72_S	0.767	0.41
84_G	110_I	0.766	0.41
23_W	30_A	0.765	0.41
70_E	73_D	0.731	0.38
67_C	81_I	0.723	0.37
54_L	110_I	0.719	0.37
73_D	76_R	0.718	0.37
67_C	71_I	0.715	0.37
48_L	63_L	0.715	0.37
6_D	107_Y	0.714	0.37
47_V	62_I	0.704	0.36
46_N	59_E	0.702	0.36
66_K	117_T	0.701	0.36
28_N	38_K	0.699	0.36
34_H	80_N	0.697	0.35
11_V	17_T	0.694	0.35
33_R	117_T	0.692	0.35
10_H	107_Y	0.691	0.35
15_Y	72_S	0.689	0.35
19_P	66_K	0.681	0.34
23_W	94_S	0.680	0.34
36_S	95_I	0.679	0.34
31_S	37_N	0.678	0.34
79_E	102_P	0.670	0.34
31_S	88_D	0.665	0.33
48_L	56_G	0.660	0.33
62_I	111_E	0.657	0.33
7_I	106_I	0.656	0.33
71_I	74_R	0.655	0.32
50_E	56_G	0.652	0.32
26_Y	46_N	0.638	0.31
76_R	116_L	0.637	0.31
55_D	108_N	0.635	0.31
45_M	109_L	0.631	0.31
42_G	60_I	0.630	0.31
51_K	89_K	0.629	0.31
38_K	102_P	0.629	0.31
78_G	114_F	0.621	0.30
17_T	32_L	0.621	0.30
9_K	78_G	0.619	0.30
7_I	36_S	0.618	0.30
5_E	44_I	0.614	0.30
8_F	41_Y	0.599	0.29
28_N	35_T	0.599	0.29
16_G	64_N	0.596	0.28
70_E	91_H	0.593	0.28
65_L	78_G	0.591	0.28
68_P	80_N	0.588	0.28
17_T	117_T	0.588	0.28
24_E	110_I	0.587	0.28
47_V	64_N	0.586	0.28
58_G	115_H	0.582	0.27
81_I	103_E	0.574	0.27
34_H	106_I	0.569	0.27
47_V	52_L	0.566	0.26
15_Y	102_P	0.565	0.26
28_N	46_N	0.561	0.26
44_I	108_N	0.560	0.26
63_L	108_N	0.560	0.26
59_E	79_E	0.554	0.26
67_C	73_D	0.551	0.26
5_E	109_L	0.547	0.25
35_T	57_H	0.547	0.25
13_E	57_H	0.542	0.25
20_D	43_L	0.542	0.25
20_D	33_R	0.541	0.25
47_V	85_Y	0.541	0.25
4_R	54_L	0.534	0.24
74_R	90_E	0.534	0.24
67_C	109_L	0.533	0.24
72_S	89_K	0.533	0.24
34_H	43_L	0.532	0.24
39_K	51_K	0.532	0.24
13_E	94_S	0.532	0.24
11_V	116_L	0.529	0.24
26_Y	64_N	0.527	0.24
38_K	111_E	0.524	0.24
14_K	110_I	0.521	0.24
68_P	104_G	0.518	0.24
69_P	115_H	0.517	0.23
80_N	99_R	0.516	0.23
59_E	63_L	0.509	0.23
81_I	101_D	0.505	0.23
37_N	49_P	0.504	0.23
87_M	116_L	0.502	0.23
38_K	57_H	0.500	0.23
16_G	57_H	0.500	0.23

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2kfpA	1	0.9915	100	0.34	Contact Map
2a1vA	1	0.8983	100	0.49	Contact Map
2fkiA	1	0.8729	99.9	0.524	Contact Map
2od0A	2	0.8051	95.8	0.878	Contact Map
1sc3B	2	0.6356	29.9	0.939	Contact Map
2i8dA	2	0.8136	20.4	0.943	Contact Map
3pvlA	1	0.8475	13.9	0.947	Contact Map
3rjmB	2	0.6356	13.1	0.948	Contact Map
2oc6A	1	0.822	11.5	0.949	Contact Map
2dkoB	2	0.678	10.6	0.95	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0058 seconds.