YYBC - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YYBC - Uncharacterized protein YybC

UniProt:	P37501	Sequences: MPANKKEGLIFGVMMCFGMVCVMSIYNAIINRAIYDFSLMTVFEMVIGFMIALLLDLLLVGPLAKKIAFRMPFDKTKKIYVILAMSTCMVIGMVLCMSVFGLVTAVLANGLNGDSLFSAYLMIVLKNFILAYPLQLLIMGPLVRGVFMKFVKPKLTAAI	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	159 (148)
Sequences:	369 (276)
Seq/√Len:	22.7

BACSU - YYBC

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
16_C	49_F	3.105	1.00
145_G	149_K	2.890	0.99
14_M	146_V	2.494	0.98
25_I	41_T	2.493	0.98
17_F	42_V	2.470	0.98
55_L	96_C	2.352	0.97
62_P	66_K	2.266	0.97
68_A	84_A	2.214	0.96
56_D	89_M	1.976	0.93
64_A	68_A	1.961	0.93
53_L	57_L	1.945	0.92
135_Q	140_G	1.892	0.91
22_V	134_L	1.882	0.91
143_V	147_F	1.874	0.91
147_F	151_V	1.868	0.91
19_M	23_M	1.844	0.90
90_V	132_Y	1.843	0.90
19_M	140_G	1.835	0.90
61_G	65_K	1.832	0.90
94_V	101_G	1.776	0.88
18_G	143_V	1.774	0.88
49_F	53_L	1.755	0.88
15_M	19_M	1.736	0.87
56_D	65_K	1.733	0.87
84_A	88_C	1.673	0.85
5_K	58_L	1.655	0.84
67_I	137_L	1.652	0.84
68_A	85_M	1.641	0.84
122_M	126_K	1.624	0.83
57_L	62_P	1.608	0.83
21_C	25_I	1.606	0.83
6_K	151_V	1.601	0.82
16_C	61_G	1.597	0.82
21_C	38_S	1.564	0.81
16_C	53_L	1.560	0.81
4_N	10_I	1.521	0.79
60_V	96_C	1.442	0.75
60_V	92_G	1.429	0.74
60_V	89_M	1.422	0.74
140_G	144_R	1.385	0.72
82_I	89_M	1.341	0.69
10_I	151_V	1.334	0.69
95_L	120_Y	1.316	0.68
36_D	40_M	1.313	0.68
59_L	145_G	1.278	0.66
86_S	140_G	1.276	0.66
9_L	84_A	1.269	0.65
77_K	80_Y	1.265	0.65
56_D	86_S	1.248	0.64
20_V	52_A	1.243	0.63
93_M	97_M	1.229	0.63
16_C	24_S	1.211	0.61
23_M	27_N	1.207	0.61
83_L	99_V	1.186	0.60
68_A	98_S	1.175	0.59
94_V	100_F	1.174	0.59
42_V	46_V	1.174	0.59
16_C	52_A	1.154	0.58
5_K	9_L	1.138	0.56
148_M	151_V	1.134	0.56
24_S	46_V	1.134	0.56
50_M	82_I	1.130	0.56
120_Y	139_M	1.124	0.56
20_V	86_S	1.123	0.55
51_I	96_C	1.093	0.53
91_I	136_L	1.091	0.53
2_P	53_L	1.086	0.53
4_N	14_M	1.081	0.53
94_V	129_I	1.072	0.52
133_P	137_L	1.065	0.51
52_A	97_M	1.059	0.51
21_C	41_T	1.058	0.51
96_C	99_V	1.050	0.50
129_I	133_P	1.043	0.50
9_L	57_L	1.037	0.50
12_G	19_M	1.033	0.49
94_V	133_P	1.029	0.49
134_L	139_M	1.028	0.49
95_L	124_V	1.023	0.49
65_K	69_F	1.019	0.48
15_M	140_G	1.012	0.48
14_M	143_V	1.007	0.47
26_Y	135_Q	1.000	0.47
29_I	41_T	0.998	0.47
20_V	45_M	0.996	0.47
43_F	46_V	0.990	0.46
101_G	137_L	0.989	0.46
44_E	48_G	0.987	0.46
52_A	60_V	0.983	0.46
107_L	117_F	0.977	0.45
11_F	102_L	0.972	0.45
67_I	88_C	0.969	0.45
83_L	136_L	0.966	0.45
18_G	142_L	0.964	0.45
5_K	93_M	0.958	0.44
19_M	86_S	0.951	0.44
26_Y	30_I	0.950	0.44
5_K	10_I	0.947	0.43
46_V	148_M	0.945	0.43
15_M	143_V	0.945	0.43
20_V	64_A	0.943	0.43
87_T	136_L	0.940	0.43
79_I	82_I	0.930	0.42
68_A	88_C	0.913	0.41
11_F	134_L	0.912	0.41
40_M	43_F	0.906	0.41
6_K	16_C	0.882	0.39
10_I	37_F	0.871	0.38
95_L	129_I	0.869	0.38
23_M	132_Y	0.855	0.37
13_V	111_L	0.851	0.37
15_M	23_M	0.851	0.37
56_D	67_I	0.850	0.37
82_I	111_L	0.848	0.37
100_F	120_Y	0.844	0.37
33_A	151_V	0.835	0.36
8_G	143_V	0.834	0.36
67_I	146_V	0.831	0.36
8_G	56_D	0.816	0.35
2_P	7_E	0.813	0.35
100_F	129_I	0.811	0.34
24_S	94_V	0.786	0.33
37_F	118_S	0.780	0.33
32_R	37_F	0.778	0.32
55_L	59_L	0.770	0.32
45_M	99_V	0.766	0.32
128_F	145_G	0.765	0.32
25_I	28_A	0.760	0.31
59_L	152_K	0.757	0.31
40_M	75_K	0.744	0.30
56_D	107_L	0.744	0.30
4_N	24_S	0.743	0.30
50_M	138_I	0.733	0.30
2_P	9_L	0.732	0.30
16_C	89_M	0.730	0.30
18_G	115_S	0.722	0.29
30_I	129_I	0.722	0.29
11_F	131_A	0.721	0.29
74_D	78_K	0.713	0.29
65_K	77_K	0.709	0.28
4_N	7_E	0.708	0.28
42_V	123_I	0.706	0.28
125_L	130_L	0.705	0.28
15_M	147_F	0.705	0.28
63_L	128_F	0.704	0.28
69_F	81_V	0.702	0.28
22_V	130_L	0.697	0.28
124_V	151_V	0.695	0.28
12_G	98_S	0.691	0.27
19_M	27_N	0.690	0.27
30_I	152_K	0.687	0.27
65_K	89_M	0.684	0.27
32_R	54_L	0.680	0.27
49_F	52_A	0.667	0.26
16_C	45_M	0.665	0.26
39_L	43_F	0.663	0.26
56_D	60_V	0.658	0.26
52_A	86_S	0.657	0.26
7_E	101_G	0.654	0.25
110_G	121_L	0.652	0.25
72_P	81_V	0.651	0.25
116_L	149_K	0.651	0.25
117_F	128_F	0.650	0.25
10_I	150_F	0.648	0.25
79_I	91_I	0.644	0.25
53_L	58_L	0.640	0.25
32_R	40_M	0.634	0.24
54_L	117_F	0.629	0.24
77_K	83_L	0.627	0.24
143_V	151_V	0.622	0.24
15_M	135_Q	0.618	0.24
4_N	8_G	0.618	0.24
12_G	23_M	0.617	0.24
80_Y	84_A	0.616	0.23
56_D	82_I	0.615	0.23
18_G	145_G	0.612	0.23
8_G	16_C	0.609	0.23
98_S	123_I	0.605	0.23
69_F	85_M	0.604	0.23
75_K	81_V	0.603	0.23
12_G	18_G	0.597	0.23
102_L	123_I	0.596	0.22
15_M	68_A	0.595	0.22
137_L	142_L	0.594	0.22
24_S	56_D	0.593	0.22
40_M	136_L	0.592	0.22
47_I	50_M	0.588	0.22
16_C	88_C	0.583	0.22
39_L	123_I	0.583	0.22
28_A	133_P	0.582	0.22
56_D	93_M	0.580	0.22
30_I	109_N	0.576	0.22
58_L	148_M	0.574	0.21
31_N	51_I	0.571	0.21
34_I	118_S	0.569	0.21
40_M	90_V	0.563	0.21
23_M	97_M	0.561	0.21
23_M	140_G	0.559	0.21
51_I	55_L	0.555	0.21
10_I	33_A	0.551	0.20
10_I	13_V	0.548	0.20
31_N	109_N	0.548	0.20
30_I	130_L	0.548	0.20
42_V	128_F	0.544	0.20
26_Y	98_S	0.544	0.20
6_K	92_G	0.541	0.20
28_A	66_K	0.539	0.20
54_L	100_F	0.537	0.20
2_P	148_M	0.536	0.20
66_K	132_Y	0.527	0.19
11_F	120_Y	0.522	0.19
12_G	15_M	0.517	0.19
55_L	58_L	0.515	0.19
66_K	133_P	0.514	0.19
9_L	13_V	0.512	0.19
72_P	76_T	0.511	0.19
29_I	46_V	0.510	0.19
19_M	135_Q	0.509	0.19
127_N	144_R	0.507	0.18
15_M	86_S	0.504	0.18
50_M	110_G	0.502	0.18
19_M	131_A	0.500	0.18

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4p6vB	1	0.3774	19.1	0.947	Contact Map
3rlbA	1	0.8931	13.6	0.951	Contact Map
4tnwA	3	0.6604	6.1	0.958	Contact Map
4tkrA	2	0.9057	4.2	0.961	Contact Map
3rqwA	4	0.5849	3.9	0.962	Contact Map
4gc0A	1	0.8931	3.2	0.963	Contact Map
4rfsS	1	0.8931	2.8	0.964	Contact Map
4p6vE	1	0.5912	2.7	0.964	Contact Map
4hfiA	3	0.6226	2.5	0.965	Contact Map
2lkgA	1	0.4214	2.5	0.965	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0068 seconds.