YYBG - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YYBG - Uncharacterized protein YybG

UniProt:	P37497	Sequences: MSAEVTLHDNIHYDLSADCQHCFGLCCVALPYAKSADFAFDKDGGTPCRNLQSNYQCSIHKDLREKGFRGCSAYECFGAGQKVSQITYEGKDWRNSPETANQMFDVFPIMQQLHEMLWYLHEALSIDIAKPIHSELRTTFEKIERLTRLSKERLLTLQVDEHRAEVNEWLLKTSELVRAQARHPKLPKKVSRGSVLIGAKLKGLDLRGANLRGALLIAADLRNADLRMTDFIGADMRDADLSGADLTGSIFLTQAQVNAANGDSNTKLPLSVRTPAHWK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	279 (263)
Sequences:	502 (364)
Seq/√Len:	22.5

BACSU - YYBG

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
218_A	238_D	6.392	1.00
143_I	162_H	5.645	1.00
83_V	106_V	4.489	1.00
23_F	84_S	4.392	1.00
40_F	49_R	3.990	1.00
243_G	263_D	3.934	1.00
167_N	232_I	3.916	1.00
92_D	95_N	3.805	1.00
40_F	68_F	3.655	1.00
82_K	147_T	3.600	1.00
142_K	165_E	3.540	1.00
62_D	66_K	3.381	1.00
88_Y	102_Q	3.084	1.00
211_L	231_F	2.765	0.99
150_S	153_R	2.640	0.99
204_L	224_A	2.629	0.99
174_S	230_D	2.360	0.97
254_Q	258_N	2.324	0.97
33_A	39_A	2.298	0.97
257_V	268_L	2.267	0.97
112_Q	163_R	2.220	0.96
30_L	218_A	2.203	0.96
221_L	241_L	2.147	0.95
174_S	178_R	2.140	0.95
87_T	110_M	2.067	0.94
121_H	140_F	2.034	0.94
17_A	75_E	1.899	0.91
82_K	86_I	1.848	0.90
149_L	153_R	1.821	0.89
46_T	49_R	1.815	0.89
102_Q	152_E	1.807	0.89
59_I	66_K	1.796	0.89
37_D	108_P	1.787	0.88
240_D	261_N	1.762	0.88
129_A	132_I	1.747	0.87
31_P	218_A	1.744	0.87
82_K	144_E	1.739	0.87
173_T	177_V	1.719	0.86
88_Y	155_L	1.717	0.86
135_E	172_K	1.689	0.85
253_T	258_N	1.670	0.85
197_I	215_L	1.667	0.85
222_R	242_S	1.635	0.83
204_L	227_R	1.602	0.82
129_A	176_L	1.595	0.82
242_S	263_D	1.593	0.82
129_A	133_H	1.583	0.81
200_K	224_A	1.555	0.80
30_L	258_N	1.547	0.80
200_K	227_R	1.539	0.79
43_D	46_T	1.530	0.79
31_P	37_D	1.526	0.79
124_L	133_H	1.517	0.78
167_N	171_L	1.517	0.78
200_K	220_D	1.514	0.78
133_H	137_R	1.498	0.77
75_E	111_Q	1.492	0.77
124_L	137_R	1.486	0.77
222_R	240_D	1.486	0.77
39_A	49_R	1.477	0.76
74_Y	88_Y	1.435	0.74
124_L	140_F	1.431	0.74
110_M	151_K	1.397	0.72
122_E	126_I	1.375	0.71
200_K	204_L	1.372	0.71
139_T	169_W	1.371	0.71
110_M	147_T	1.345	0.69
33_A	37_D	1.303	0.67
30_L	40_F	1.301	0.67
231_F	236_M	1.292	0.66
110_M	222_R	1.288	0.66
171_L	232_I	1.280	0.65
37_D	68_F	1.277	0.65
30_L	238_D	1.265	0.64
241_L	260_A	1.254	0.64
142_K	145_R	1.252	0.64
136_L	169_W	1.251	0.64
201_L	211_L	1.244	0.63
123_A	136_L	1.242	0.63
49_R	68_F	1.235	0.63
31_P	255_A	1.219	0.61
275_P	278_W	1.215	0.61
14_D	21_H	1.208	0.61
229_T	232_I	1.201	0.60
30_L	43_D	1.198	0.60
224_A	227_R	1.197	0.60
111_Q	116_M	1.194	0.60
61_K	153_R	1.194	0.60
194_S	214_A	1.194	0.60
209_A	229_T	1.170	0.58
201_L	221_L	1.166	0.58
74_Y	110_M	1.165	0.58
22_C	26_C	1.160	0.58
39_A	68_F	1.142	0.56
31_P	40_F	1.125	0.55
112_Q	253_T	1.124	0.55
29_A	218_A	1.120	0.55
34_K	215_L	1.116	0.55
17_A	44_G	1.113	0.54
74_Y	108_P	1.095	0.53
14_D	82_K	1.092	0.53
69_R	238_D	1.091	0.53
34_K	125_S	1.085	0.52
262_G	278_W	1.083	0.52
65_E	249_S	1.080	0.52
262_G	275_P	1.077	0.52
199_A	231_F	1.069	0.51
167_N	210_N	1.063	0.51
109_I	132_I	1.059	0.51
19_C	27_C	1.045	0.50
36_A	73_A	1.039	0.49
135_E	257_V	1.038	0.49
91_K	96_S	1.037	0.49
210_N	232_I	1.033	0.49
122_E	252_L	1.024	0.48
55_Y	97_P	1.020	0.48
126_I	177_V	1.020	0.48
36_A	255_A	1.015	0.48
13_Y	16_S	1.015	0.48
178_R	225_D	1.006	0.47
254_Q	262_G	0.990	0.46
24_G	29_A	0.979	0.45
82_K	148_R	0.977	0.45
64_R	72_S	0.973	0.45
197_I	270_L	0.972	0.45
93_W	104_F	0.971	0.45
33_A	210_N	0.969	0.45
89_E	96_S	0.950	0.43
96_S	99_T	0.950	0.43
139_T	167_N	0.945	0.43
46_T	95_N	0.938	0.42
245_D	267_K	0.937	0.42
55_Y	100_A	0.937	0.42
39_A	50_N	0.936	0.42
88_Y	152_E	0.934	0.42
30_L	112_Q	0.932	0.42
134_S	239_A	0.931	0.42
135_E	145_R	0.923	0.41
193_G	196_L	0.919	0.41
135_E	140_F	0.917	0.41
43_D	156_T	0.915	0.41
208_G	215_L	0.909	0.40
31_P	36_A	0.907	0.40
13_Y	101_N	0.902	0.40
134_S	150_S	0.902	0.40
30_L	253_T	0.901	0.40
175_E	210_N	0.900	0.40
153_R	273_R	0.898	0.40
172_K	247_T	0.887	0.39
183_H	188_K	0.870	0.38
199_A	224_A	0.870	0.38
83_V	107_F	0.861	0.37
204_L	257_V	0.858	0.37
44_G	121_H	0.851	0.37
86_I	228_M	0.849	0.37
74_Y	107_F	0.847	0.36
150_S	180_Q	0.844	0.36
154_L	157_L	0.838	0.36
127_D	189_K	0.835	0.36
16_S	62_D	0.829	0.35
142_K	172_K	0.824	0.35
125_S	128_I	0.821	0.35
124_L	136_L	0.818	0.35
98_E	138_T	0.818	0.35
69_R	228_M	0.812	0.34
98_E	239_A	0.811	0.34
41_D	222_R	0.806	0.34
204_L	248_G	0.803	0.34
34_K	95_N	0.803	0.34
102_Q	106_V	0.803	0.34
46_T	156_T	0.801	0.34
70_G	76_C	0.799	0.33
171_L	210_N	0.795	0.33
140_F	143_I	0.793	0.33
71_C	76_C	0.791	0.33
23_F	103_M	0.791	0.33
115_E	213_G	0.790	0.33
64_R	198_G	0.784	0.33
174_S	177_V	0.781	0.32
41_D	215_L	0.780	0.32
92_D	104_F	0.776	0.32
194_S	274_T	0.775	0.32
145_R	273_R	0.775	0.32
83_V	110_M	0.770	0.32
36_A	276_A	0.770	0.32
36_A	39_A	0.765	0.31
14_D	271_S	0.763	0.31
181_A	188_K	0.762	0.31
179_A	208_G	0.762	0.31
151_K	182_R	0.761	0.31
95_N	276_A	0.761	0.31
23_F	99_T	0.760	0.31
223_N	231_F	0.759	0.31
134_S	138_T	0.756	0.31
32_Y	111_Q	0.754	0.31
257_V	267_K	0.754	0.31
17_A	241_L	0.751	0.31
30_L	47_P	0.750	0.31
105_D	187_P	0.747	0.30
20_Q	61_K	0.741	0.30
191_S	245_D	0.741	0.30
99_T	273_R	0.740	0.30
178_R	200_K	0.740	0.30
237_R	256_Q	0.737	0.30
13_Y	228_M	0.733	0.30
46_T	150_S	0.731	0.29
39_A	108_P	0.729	0.29
154_L	215_L	0.727	0.29
17_A	31_P	0.720	0.29
265_N	276_A	0.717	0.29
47_P	218_A	0.716	0.29
21_H	180_Q	0.711	0.28
95_N	188_K	0.709	0.28
46_T	149_L	0.708	0.28
37_D	203_G	0.708	0.28
164_A	181_A	0.702	0.28
65_E	83_V	0.698	0.28
155_L	276_A	0.693	0.27
130_K	176_L	0.693	0.27
73_A	108_P	0.692	0.27
24_G	136_L	0.692	0.27
201_L	239_A	0.683	0.27
89_E	97_P	0.683	0.27
63_L	80_G	0.682	0.27
16_S	148_R	0.680	0.27
188_K	208_G	0.678	0.26
122_E	251_F	0.677	0.26
48_C	63_L	0.677	0.26
138_T	152_E	0.677	0.26
46_T	270_L	0.675	0.26
126_I	250_I	0.674	0.26
16_S	274_T	0.673	0.26
19_C	22_C	0.672	0.26
34_K	276_A	0.669	0.26
261_N	270_L	0.668	0.26
36_A	248_G	0.665	0.26
42_K	48_C	0.665	0.26
43_D	130_K	0.664	0.26
216_L	234_A	0.663	0.26
13_Y	53_S	0.662	0.26
52_Q	58_S	0.661	0.26
24_G	30_L	0.658	0.25
19_C	26_C	0.657	0.25
54_N	194_S	0.656	0.25
66_K	223_N	0.656	0.25
224_A	248_G	0.655	0.25
241_L	247_T	0.655	0.25
62_D	132_I	0.655	0.25
60_H	114_H	0.650	0.25
231_F	252_L	0.649	0.25
217_I	232_I	0.649	0.25
17_A	255_A	0.648	0.25
13_Y	157_L	0.647	0.25
53_S	159_V	0.644	0.25
132_I	145_R	0.643	0.25
249_S	265_N	0.641	0.25
86_I	99_T	0.640	0.25
70_G	80_G	0.636	0.24
67_G	115_E	0.635	0.24
142_K	157_L	0.633	0.24
91_K	95_N	0.631	0.24
119_Y	167_N	0.630	0.24
29_A	104_F	0.628	0.24
123_A	173_T	0.624	0.24
238_D	254_Q	0.623	0.24
41_D	191_S	0.623	0.24
172_K	204_L	0.623	0.24
76_C	80_G	0.620	0.24
107_F	262_G	0.619	0.23
187_P	202_K	0.618	0.23
218_A	254_Q	0.617	0.23
157_L	162_H	0.616	0.23
177_V	210_N	0.616	0.23
112_Q	157_L	0.614	0.23
91_K	207_R	0.612	0.23
112_Q	258_N	0.611	0.23
161_E	207_R	0.611	0.23
72_S	87_T	0.610	0.23
16_S	34_K	0.610	0.23
16_S	44_G	0.609	0.23
34_K	145_R	0.608	0.23
210_N	222_R	0.607	0.23
141_E	145_R	0.606	0.23
136_L	176_L	0.605	0.23
91_K	223_N	0.605	0.23
18_D	25_L	0.604	0.23
45_G	51_L	0.604	0.23
37_D	277_H	0.603	0.23
57_C	63_L	0.601	0.23
71_C	80_G	0.597	0.22
49_R	191_S	0.596	0.22
193_G	210_N	0.594	0.22
102_Q	121_H	0.594	0.22
179_A	255_A	0.593	0.22
76_C	81_Q	0.593	0.22
167_N	173_T	0.592	0.22
76_C	79_A	0.592	0.22
160_D	168_E	0.589	0.22
91_K	270_L	0.588	0.22
77_F	90_G	0.588	0.22
134_S	249_S	0.587	0.22
262_G	266_T	0.586	0.22
44_G	55_Y	0.585	0.22
28_V	43_D	0.585	0.22
266_T	269_P	0.582	0.22
20_Q	228_M	0.581	0.22
65_E	145_R	0.581	0.22
60_H	81_Q	0.580	0.22
142_K	236_M	0.579	0.22
110_M	249_S	0.577	0.21
46_T	105_D	0.577	0.21
57_C	60_H	0.576	0.21
85_Q	90_G	0.575	0.21
112_Q	251_F	0.574	0.21
74_Y	197_I	0.571	0.21
28_V	40_F	0.570	0.21
131_P	176_L	0.567	0.21
38_F	78_G	0.567	0.21
139_T	143_I	0.564	0.21
28_V	239_A	0.562	0.21
50_N	82_K	0.562	0.21
212_R	230_D	0.561	0.21
71_C	81_Q	0.560	0.21
191_S	200_K	0.560	0.21
39_A	168_E	0.559	0.21
75_E	84_S	0.557	0.21
173_T	271_S	0.556	0.20
172_K	175_E	0.556	0.20
131_P	138_T	0.555	0.20
196_L	216_L	0.553	0.20
84_S	108_P	0.553	0.20
116_M	193_G	0.552	0.20
57_C	76_C	0.551	0.20
183_H	208_G	0.551	0.20
57_C	81_Q	0.551	0.20
24_G	55_Y	0.551	0.20
142_K	242_S	0.550	0.20
95_N	179_A	0.549	0.20
82_K	110_M	0.549	0.20
162_H	231_F	0.549	0.20
85_Q	103_M	0.549	0.20
70_G	78_G	0.546	0.20
101_N	153_R	0.546	0.20
22_C	27_C	0.545	0.20
101_N	265_N	0.545	0.20
21_H	36_A	0.545	0.20
51_L	57_C	0.544	0.20
116_M	210_N	0.543	0.20
115_E	230_D	0.541	0.20
17_A	74_Y	0.537	0.20
52_Q	110_M	0.536	0.20
203_G	224_A	0.536	0.20
219_A	231_F	0.536	0.20
20_Q	46_T	0.536	0.20
153_R	271_S	0.535	0.20
159_V	172_K	0.535	0.20
134_S	176_L	0.535	0.20
233_G	237_R	0.534	0.20
138_T	191_S	0.534	0.20
259_A	277_H	0.534	0.20
236_M	259_A	0.534	0.20
34_K	44_G	0.533	0.19
62_D	68_F	0.531	0.19
63_L	76_C	0.530	0.19
30_L	84_S	0.529	0.19
13_Y	46_T	0.528	0.19
73_A	224_A	0.527	0.19
36_A	111_Q	0.521	0.19
82_K	87_T	0.518	0.19
63_L	78_G	0.518	0.19
195_V	236_M	0.518	0.19
64_R	67_G	0.517	0.19
218_A	258_N	0.517	0.19
126_I	241_L	0.516	0.19
36_A	273_R	0.514	0.19
20_Q	267_K	0.510	0.19
107_F	254_Q	0.509	0.18
60_H	235_D	0.509	0.18
194_S	259_A	0.508	0.18
131_P	169_W	0.507	0.18
14_D	164_A	0.507	0.18
117_L	211_L	0.506	0.18
71_C	79_A	0.506	0.18
81_Q	235_D	0.505	0.18
134_S	141_E	0.504	0.18
60_H	63_L	0.503	0.18
255_A	268_L	0.503	0.18
16_S	33_A	0.503	0.18
13_Y	20_Q	0.501	0.18
20_Q	69_R	0.501	0.18
16_S	176_L	0.501	0.18
34_K	163_R	0.500	0.18
33_A	167_N	0.500	0.18
53_S	121_H	0.500	0.18

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2qyuA	1	0.5341	99.9	0.773	Contact Map
2o6wA	1	0.4803	99.8	0.792	Contact Map
3du1X	1	0.4624	99.8	0.796	Contact Map
3n90A	1	0.4122	99.8	0.798	Contact Map
3nb2A	2	0.5484	99.8	0.804	Contact Map
2j8kA	1	0.5233	99.7	0.807	Contact Map
2f3lA	1	0.3943	99.7	0.816	Contact Map
4jraC	1	0.3333	99.7	0.819	Contact Map
2w7zA	2	0.6022	99.6	0.823	Contact Map
3pssA	2	0.4552	99.6	0.832	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.009 seconds.