DIVIC - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DIVIC - Cell division protein DivIC

UniProt:	P37471	Sequences: MNFSRERTITEIQNDYKEQVERQNQLKKRRRKGLYRRLTVFGALVFLTAIVLASSVWSQTSSLSAKEEKKEQLEKELKSLKTKQTDLKEEISKLKDEDYVTELARRDLFMSGDGEIIFNVEKKSK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	125 (117)
Sequences:	373 (311)
Seq/√Len:	28.8

BACSU - DIVIC

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
111_S	117_I	8.042	1.00
103_L	106_R	3.974	1.00
14_N	17_K	2.727	1.00
95_K	100_V	2.439	0.99
36_R	63_L	2.295	0.99
58_S	108_L	2.108	0.98
29_R	33_G	1.958	0.96
107_D	118_F	1.920	0.96
111_S	116_I	1.891	0.95
31_R	34_L	1.829	0.94
20_V	23_Q	1.817	0.94
94_L	111_S	1.814	0.94
34_L	118_F	1.770	0.93
35_Y	39_T	1.767	0.93
55_S	118_F	1.743	0.93
68_E	72_Q	1.684	0.91
97_E	117_I	1.654	0.91
89_E	93_K	1.650	0.91
107_D	110_M	1.600	0.89
12_I	19_Q	1.556	0.88
41_F	45_V	1.553	0.88
59_Q	118_F	1.542	0.87
100_V	110_M	1.522	0.87
12_I	25_Q	1.522	0.87
37_R	87_L	1.497	0.86
104_A	109_F	1.495	0.86
11_E	14_N	1.452	0.84
48_T	111_S	1.447	0.84
77_L	100_V	1.435	0.83
11_E	17_K	1.423	0.83
105_R	115_E	1.401	0.82
43_A	71_E	1.382	0.81
77_L	81_K	1.380	0.81
105_R	112_G	1.349	0.79
70_K	101_T	1.348	0.79
88_K	92_S	1.347	0.79
19_Q	29_R	1.259	0.74
7_R	117_I	1.250	0.74
8_T	18_E	1.237	0.73
48_T	102_E	1.229	0.72
42_G	47_L	1.192	0.70
26_L	93_K	1.172	0.69
16_Y	111_S	1.140	0.66
99_Y	112_G	1.131	0.66
6_E	52_L	1.123	0.65
73_L	80_L	1.123	0.65
40_V	109_F	1.114	0.65
83_K	86_D	1.103	0.64
82_T	101_T	1.097	0.63
41_F	47_L	1.068	0.61
101_T	121_E	1.066	0.61
80_L	84_Q	1.054	0.60
47_L	78_K	1.051	0.60
100_V	107_D	1.047	0.60
8_T	15_D	1.015	0.57
54_S	93_K	1.008	0.57
114_G	119_N	1.001	0.56
63_L	85_T	0.986	0.55
59_Q	107_D	0.985	0.55
104_A	110_M	0.978	0.54
76_E	79_S	0.974	0.54
21_E	102_E	0.954	0.53
7_R	10_T	0.949	0.52
56_V	81_K	0.943	0.52
8_T	13_Q	0.929	0.51
66_K	83_K	0.926	0.50
34_L	109_F	0.924	0.50
68_E	71_E	0.917	0.50
96_D	122_K	0.913	0.49
41_F	106_R	0.913	0.49
18_E	76_E	0.905	0.49
45_V	52_L	0.898	0.48
17_K	49_A	0.888	0.47
22_R	83_K	0.888	0.47
57_W	68_E	0.885	0.47
85_T	114_G	0.880	0.47
9_I	57_W	0.879	0.47
36_R	43_A	0.876	0.47
33_G	106_R	0.876	0.47
65_A	82_T	0.866	0.46
119_N	122_K	0.858	0.45
8_T	62_S	0.858	0.45
42_G	119_N	0.847	0.44
100_V	104_A	0.839	0.44
31_R	69_K	0.833	0.43
41_F	85_T	0.814	0.42
23_Q	108_L	0.801	0.41
70_K	93_K	0.794	0.40
34_L	38_L	0.788	0.40
77_L	107_D	0.787	0.40
15_D	18_E	0.787	0.40
101_T	104_A	0.784	0.40
55_S	60_T	0.780	0.39
103_L	107_D	0.778	0.39
54_S	83_K	0.772	0.39
28_K	51_V	0.766	0.38
58_S	95_K	0.765	0.38
15_D	20_V	0.759	0.38
105_R	111_S	0.746	0.37
39_T	50_I	0.745	0.37
69_K	78_K	0.744	0.37
9_I	15_D	0.742	0.36
11_E	21_E	0.740	0.36
94_L	102_E	0.725	0.35
30_R	35_Y	0.723	0.35
49_A	95_K	0.712	0.34
32_K	74_E	0.706	0.34
59_Q	110_M	0.705	0.34
110_M	117_I	0.701	0.34
26_L	30_R	0.684	0.32
52_L	121_E	0.684	0.32
63_L	103_L	0.682	0.32
62_S	117_I	0.682	0.32
93_K	116_I	0.682	0.32
8_T	39_T	0.681	0.32
85_T	89_E	0.679	0.32
42_G	118_F	0.675	0.32
56_V	98_D	0.668	0.31
66_K	79_S	0.656	0.31
75_K	95_K	0.656	0.31
57_W	120_V	0.654	0.30
74_E	113_D	0.654	0.30
57_W	113_D	0.643	0.30
65_A	85_T	0.641	0.30
49_A	118_F	0.639	0.29
6_E	46_F	0.637	0.29
19_Q	22_R	0.631	0.29
38_L	45_V	0.630	0.29
9_I	51_V	0.630	0.29
48_T	52_L	0.628	0.29
44_L	90_E	0.626	0.29
97_E	100_V	0.622	0.28
24_N	103_L	0.620	0.28
51_V	55_S	0.619	0.28
26_L	50_I	0.616	0.28
117_I	121_E	0.616	0.28
6_E	68_E	0.615	0.28
91_I	95_K	0.609	0.28
101_T	110_M	0.607	0.27
46_F	83_K	0.606	0.27
37_R	90_E	0.598	0.27
52_L	111_S	0.597	0.27
35_Y	49_A	0.597	0.27
6_E	91_I	0.594	0.27
93_K	103_L	0.593	0.27
36_R	60_T	0.591	0.26
71_E	75_K	0.590	0.26
61_S	86_D	0.579	0.26
12_I	62_S	0.575	0.25
19_Q	45_V	0.572	0.25
85_T	88_K	0.565	0.25
67_E	118_F	0.565	0.25
93_K	120_V	0.559	0.25
50_I	53_A	0.558	0.24
62_S	96_D	0.554	0.24
44_L	67_E	0.553	0.24
23_Q	68_E	0.552	0.24
18_E	73_L	0.548	0.24
23_Q	79_S	0.545	0.24
8_T	44_L	0.545	0.24
38_L	66_K	0.534	0.23
59_Q	63_L	0.531	0.23
42_G	63_L	0.530	0.23
28_K	44_L	0.526	0.23
92_S	107_D	0.526	0.23
33_G	59_Q	0.526	0.23
24_N	107_D	0.524	0.23
86_D	100_V	0.513	0.22
7_R	72_Q	0.511	0.22
19_Q	48_T	0.510	0.22
75_K	79_S	0.508	0.22
59_Q	103_L	0.506	0.22
34_L	107_D	0.506	0.22
84_Q	88_K	0.505	0.22
11_E	15_D	0.504	0.21
27_K	88_K	0.500	0.21

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4q4gX	1	0	78.3	0.885	Contact Map
1rz2A	1	0.536	69.5	0.892	Contact Map
4cgkA	3	0.44	69.3	0.892	Contact Map
4etpB	1	0.496	43	0.908	Contact Map
4dznA	3	0.256	40	0.91	Contact Map
3owqA	1	0.256	31.2	0.915	Contact Map
4e61A	2	0.48	24.6	0.919	Contact Map
2w3zA	1	0.304	24.4	0.919	Contact Map
2ap3A	1	0.664	22	0.921	Contact Map
1nlwA	1	0.6	20.3	0.922	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0059 seconds.