VEG - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

VEG - Protein Veg

UniProt:	P37466	Sequences: MAKTLSDIKRSLDGNLGKRLTLKANGGRRKTIERSGILAETYPSVFVIQLDQDENSFERVSYSYADILTETVELTFNDDAASSVAF	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	86 (76)
Sequences:	322 (160)
Seq/√Len:	18.3

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
39_A	49_Q	3.683	1.00
9_K	13_D	2.774	0.98
31_T	67_I	2.753	0.98
41_T	74_L	2.267	0.94
50_L	60_V	2.142	0.92
12_L	38_L	2.043	0.90
45_V	63_S	1.988	0.88
16_L	21_T	1.922	0.87
22_L	72_V	1.856	0.85
20_L	60_V	1.847	0.84
13_D	41_T	1.841	0.84
26_G	32_I	1.754	0.81
33_E	52_Q	1.571	0.73
10_R	23_K	1.482	0.68
63_S	74_L	1.423	0.65
30_K	38_L	1.403	0.64
71_T	74_L	1.355	0.61
56_S	74_L	1.340	0.60
33_E	72_V	1.339	0.60
8_I	38_L	1.278	0.57
52_Q	55_N	1.265	0.56
63_S	78_D	1.255	0.55
42_Y	72_V	1.229	0.54
9_K	41_T	1.228	0.54
9_K	12_L	1.227	0.54
6_S	54_E	1.223	0.53
67_I	73_E	1.198	0.52
47_V	59_R	1.183	0.51
34_R	50_L	1.144	0.48
18_K	78_D	1.137	0.48
24_A	42_Y	1.113	0.47
21_T	33_E	1.089	0.45
35_S	44_S	1.072	0.44
18_K	37_I	1.065	0.44
15_N	18_K	1.056	0.43
4_T	29_R	1.053	0.43
33_E	73_E	1.036	0.42
16_L	24_A	1.021	0.41
20_L	55_N	1.000	0.40
51_D	58_E	0.989	0.39
32_I	45_V	0.987	0.39
21_T	42_Y	0.977	0.38
9_K	57_F	0.976	0.38
5_L	39_A	0.962	0.37
25_N	42_Y	0.955	0.37
34_R	45_V	0.953	0.37
34_R	58_E	0.943	0.36
7_D	55_N	0.924	0.35
52_Q	57_F	0.916	0.35
49_Q	76_F	0.911	0.35
29_R	65_A	0.894	0.34
45_V	62_Y	0.879	0.33
22_L	76_F	0.873	0.32
59_R	70_E	0.870	0.32
11_S	71_T	0.865	0.32
40_E	65_A	0.853	0.31
23_K	72_V	0.849	0.31
31_T	75_T	0.841	0.31
25_N	32_I	0.841	0.31
21_T	73_E	0.825	0.30
24_A	36_G	0.820	0.30
5_L	78_D	0.811	0.29
20_L	33_E	0.811	0.29
65_A	71_T	0.807	0.29
19_R	72_V	0.801	0.29
57_F	61_S	0.800	0.29
21_T	53_D	0.771	0.27
50_L	53_D	0.766	0.27
37_I	53_D	0.756	0.26
22_L	37_I	0.756	0.26
16_L	39_A	0.754	0.26
19_R	60_V	0.739	0.26
41_T	65_A	0.734	0.25
45_V	55_N	0.731	0.25
11_S	58_E	0.728	0.25
53_D	75_T	0.727	0.25
14_G	19_R	0.709	0.24
18_K	31_T	0.705	0.24
67_I	71_T	0.705	0.24
30_K	34_R	0.703	0.24
3_K	37_I	0.698	0.24
19_R	32_I	0.698	0.24
48_I	62_Y	0.695	0.24
34_R	38_L	0.673	0.23
56_S	60_V	0.666	0.22
38_L	59_R	0.658	0.22
54_E	67_I	0.656	0.22
3_K	15_N	0.637	0.21
11_S	78_D	0.635	0.21
26_G	30_K	0.625	0.21
6_S	34_R	0.619	0.20
70_E	73_E	0.614	0.20
9_K	78_D	0.612	0.20
20_L	31_T	0.612	0.20
23_K	33_E	0.608	0.20
62_Y	67_I	0.603	0.20
5_L	13_D	0.602	0.20
13_D	22_L	0.592	0.19
14_G	65_A	0.582	0.19
44_S	68_L	0.577	0.19
11_S	20_L	0.569	0.18
3_K	67_I	0.569	0.18
30_K	56_S	0.555	0.18
10_R	63_S	0.553	0.18
18_K	75_T	0.552	0.18
18_K	53_D	0.540	0.17
5_L	32_I	0.533	0.17
6_S	11_S	0.530	0.17
45_V	61_S	0.530	0.17
12_L	50_L	0.517	0.17
25_N	72_V	0.507	0.16
21_T	35_S	0.507	0.16
15_N	37_I	0.501	0.16
5_L	33_E	0.500	0.16

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3fb9A	1	0.907	100	0.205	Contact Map
1ib8A	1	0.8488	48.7	0.898	Contact Map
1y96A	1	0.9186	35.2	0.906	Contact Map
4h75A	1	0.5581	16.5	0.92	Contact Map
4mzgB	1	0.593	14.6	0.922	Contact Map
2d6fA	2	0.7907	13.4	0.923	Contact Map
4ic7E	1	0.5116	11.6	0.925	Contact Map
1zq1A	2	0.8605	11.2	0.925	Contact Map
3zey4	1	0.907	10.6	0.926	Contact Map
2au3A	1	0.9419	9.4	0.928	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0051 seconds.