FLIQ - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

FLIQ - Flagellar biosynthetic protein FliQ

UniProt:	P35535	Sequences: MSSEFVISMAEKAVYVTLMISGPLLAIALLVGLIVSIFQATTQIQEQTLAFIPKIVAVLLALIFFGPWMLSTILSFTTELFSNLNRFAG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	89 (86)
Sequences:	1786 (1139)
Seq/√Len:	122.8

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
31_V	57_A	4.207	1.00
27_I	57_A	3.304	1.00
27_I	61_A	3.222	1.00
12_K	79_E	2.657	1.00
61_A	65_F	2.644	1.00
37_I	41_T	2.580	1.00
17_T	59_L	2.171	1.00
20_I	69_M	2.141	1.00
26_A	30_L	2.102	1.00
74_L	78_T	1.923	1.00
78_T	82_S	1.703	1.00
19_M	72_T	1.677	1.00
41_T	45_Q	1.667	1.00
56_V	60_L	1.606	1.00
28_A	58_V	1.529	1.00
83_N	86_R	1.517	1.00
16_V	72_T	1.455	1.00
79_E	83_N	1.453	1.00
40_A	43_Q	1.430	1.00
40_A	45_Q	1.344	1.00
12_K	15_Y	1.331	1.00
46_E	49_L	1.310	1.00
45_Q	75_S	1.309	1.00
77_T	81_F	1.295	1.00
24_L	69_M	1.258	1.00
81_F	84_L	1.251	1.00
8_S	11_E	1.213	0.99
18_L	56_V	1.207	0.99
47_Q	50_A	1.202	0.99
14_V	59_L	1.200	0.99
34_I	38_F	1.183	0.99
50_A	53_P	1.158	0.99
27_I	65_F	1.147	0.99
79_E	82_S	1.140	0.99
36_S	58_V	1.126	0.99
60_L	64_F	1.126	0.99
22_G	26_A	1.090	0.99
29_L	53_P	1.077	0.98
15_Y	19_M	1.073	0.98
24_L	62_L	1.068	0.98
47_Q	52_I	1.066	0.98
23_P	54_K	1.058	0.98
23_P	27_I	1.051	0.98
45_Q	49_L	1.046	0.98
24_L	46_E	1.043	0.98
11_E	15_Y	1.042	0.98
35_V	52_I	0.991	0.97
20_I	73_I	0.986	0.97
28_A	50_A	0.976	0.97
24_L	65_F	0.969	0.97
16_V	20_I	0.969	0.97
27_I	31_V	0.966	0.97
17_T	21_S	0.953	0.97
55_I	67_P	0.953	0.97
38_F	44_I	0.930	0.96
71_S	75_S	0.925	0.96
8_S	12_K	0.883	0.95
25_L	36_S	0.882	0.95
70_L	74_L	0.871	0.95
16_V	19_M	0.862	0.94
28_A	48_T	0.857	0.94
59_L	63_I	0.841	0.93
25_L	52_I	0.840	0.93
77_T	80_L	0.788	0.91
21_S	52_I	0.786	0.91
68_W	72_T	0.771	0.90
12_K	76_F	0.761	0.90
5_F	83_N	0.756	0.89
75_S	78_T	0.751	0.89
10_A	18_L	0.749	0.89
3_S	67_P	0.747	0.89
23_P	45_Q	0.747	0.89
15_Y	45_Q	0.730	0.88
10_A	14_V	0.728	0.87
2_S	5_F	0.727	0.87
75_S	79_E	0.724	0.87
46_E	50_A	0.722	0.87
5_F	8_S	0.722	0.87
13_A	40_A	0.720	0.87
36_S	43_Q	0.712	0.86
4_E	8_S	0.704	0.86
44_I	48_T	0.694	0.85
29_L	51_F	0.668	0.83
26_A	62_L	0.662	0.82
17_T	66_G	0.655	0.81
13_A	46_E	0.653	0.81
43_Q	67_P	0.640	0.80
53_P	59_L	0.640	0.80
2_S	63_I	0.640	0.80
24_L	61_A	0.638	0.80
36_S	68_W	0.634	0.79
81_F	85_N	0.633	0.79
8_S	82_S	0.625	0.78
33_L	79_E	0.621	0.78
60_L	78_T	0.620	0.78
8_S	14_V	0.616	0.77
66_G	70_L	0.612	0.77
10_A	59_L	0.610	0.76
14_V	63_I	0.610	0.76
36_S	50_A	0.609	0.76
23_P	76_F	0.607	0.76
33_L	50_A	0.605	0.76
20_I	43_Q	0.571	0.72
33_L	53_P	0.568	0.71
55_I	59_L	0.561	0.70
62_L	65_F	0.560	0.70
24_L	58_V	0.560	0.70
41_T	81_F	0.553	0.69
33_L	37_I	0.550	0.69
3_S	6_V	0.547	0.68
76_F	86_R	0.539	0.67
7_I	11_E	0.537	0.67
46_E	66_G	0.532	0.66
35_V	53_P	0.531	0.66
15_Y	55_I	0.525	0.65
15_Y	25_L	0.522	0.65
54_K	84_L	0.520	0.65
41_T	66_G	0.520	0.65
8_S	83_N	0.517	0.64
7_I	43_Q	0.516	0.64
65_F	69_M	0.516	0.64
55_I	58_V	0.515	0.64
43_Q	77_T	0.512	0.63
38_F	59_L	0.511	0.63
3_S	74_L	0.509	0.63
33_L	44_I	0.506	0.63
6_V	71_S	0.505	0.62
12_K	16_V	0.503	0.62
16_V	76_F	0.500	0.62

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4pd6A	3	0.3933	18.8	0.909	Contact Map
3tuiA	2	0.9775	4.6	0.931	Contact Map
4ymuD	2	0.9888	3.3	0.936	Contact Map
3rlfF	1	0.9888	2.4	0.94	Contact Map
3mktA	1	0.9888	2.4	0.941	Contact Map
4dxwA	3	0.4831	2.3	0.941	Contact Map
4humA	1	0.9888	2.1	0.942	Contact Map
2fyuK	1	0.5393	1.9	0.944	Contact Map
4ij3C	1	0	1.4	0.948	Contact Map
1rypK	2	0.4944	1.2	0.95	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.005 seconds.