SPMA - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

SPMA - Spore maturation protein A

UniProt:	P35157	Sequences: MVNIIWVSLTVIGLVFAMCNGTLQDVNEAVFKGAKEAITISFGLMSVLVFWLGLMKIAEQSGLLDIFSRMCRPFISKLFPDIPPDHPAMGYILSNLMANFFGLGNAATPLGIKAMEQMKKLNGNRSEASRSMITFLAVNTSCITLIPTTVIAVRMAYSSKTPTDIVGPSILATLISGIGAIIIDRYFYYRRKKKGR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	196 (189)
Sequences:	895 (569)
Seq/√Len:	41.4

BACSU - SPMA

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
56_K	59_E	4.458	1.00
117_Q	120_K	4.024	1.00
81_D	131_S	3.185	1.00
86_H	121_L	3.051	1.00
82_I	118_M	2.966	1.00
81_D	130_R	2.963	1.00
141_S	177_G	2.957	1.00
119_K	126_S	2.870	1.00
82_I	131_S	2.808	1.00
137_A	180_A	2.752	1.00
83_P	86_H	2.747	1.00
83_P	121_L	2.635	1.00
165_I	169_S	2.585	1.00
130_R	188_Y	2.575	1.00
8_S	12_I	2.218	1.00
159_S	164_D	2.172	0.99
100_F	170_I	2.107	0.99
91_Y	117_Q	2.084	0.99
142_C	176_S	2.075	0.99
78_L	181_I	2.036	0.99
66_I	69_R	2.010	0.99
82_I	121_L	1.988	0.99
28_E	32_K	1.945	0.99
38_I	45_M	1.928	0.99
18_M	23_L	1.872	0.98
35_K	39_T	1.867	0.98
76_S	84_P	1.783	0.98
122_N	125_R	1.757	0.98
63_L	66_I	1.720	0.97
124_N	127_E	1.705	0.97
174_L	178_I	1.664	0.97
141_S	172_A	1.662	0.97
82_I	86_H	1.653	0.97
161_T	164_D	1.644	0.96
113_K	116_E	1.609	0.96
4_I	8_S	1.552	0.95
22_T	25_D	1.547	0.95
135_F	141_S	1.540	0.95
112_I	118_M	1.517	0.94
134_T	184_D	1.470	0.93
106_A	109_P	1.459	0.93
20_N	170_I	1.458	0.93
112_I	145_L	1.453	0.93
182_I	186_Y	1.452	0.93
91_Y	94_S	1.431	0.92
179_G	183_I	1.382	0.91
24_Q	28_E	1.381	0.91
75_I	89_M	1.378	0.91
150_V	169_S	1.361	0.90
103_L	109_P	1.330	0.89
134_T	181_I	1.328	0.89
88_A	118_M	1.284	0.88
49_V	170_I	1.270	0.87
87_P	121_L	1.245	0.86
96_L	142_C	1.233	0.85
119_K	122_N	1.226	0.85
83_P	87_P	1.220	0.85
2_V	6_W	1.220	0.85
185_R	188_Y	1.212	0.84
163_T	173_T	1.211	0.84
50_F	101_F	1.203	0.84
173_T	176_S	1.196	0.84
72_R	85_D	1.167	0.82
140_T	187_F	1.163	0.82
80_P	112_I	1.144	0.81
17_A	26_V	1.144	0.81
142_C	170_I	1.142	0.81
74_F	78_L	1.142	0.81
61_S	66_I	1.139	0.81
134_T	185_R	1.136	0.80
103_L	106_A	1.132	0.80
181_I	185_R	1.132	0.80
141_S	173_T	1.119	0.79
38_I	142_C	1.113	0.79
7_V	11_V	1.110	0.79
64_L	94_S	1.109	0.79
170_I	174_L	1.109	0.79
94_S	130_R	1.107	0.79
88_A	117_Q	1.103	0.78
95_N	139_N	1.096	0.78
172_A	177_G	1.092	0.78
8_S	65_D	1.080	0.77
89_M	181_I	1.080	0.77
148_T	156_A	1.041	0.74
44_L	105_N	1.040	0.74
168_P	171_L	1.036	0.74
27_N	30_V	1.028	0.73
142_C	177_G	1.020	0.73
18_M	167_G	1.015	0.72
16_F	20_N	1.015	0.72
96_L	138_V	1.007	0.72
141_S	176_S	1.001	0.71
125_R	129_S	0.993	0.71
151_I	163_T	0.991	0.70
13_G	167_G	0.975	0.69
47_V	152_A	0.971	0.69
2_V	101_F	0.970	0.69
184_D	188_Y	0.969	0.69
85_D	182_I	0.969	0.69
148_T	153_V	0.959	0.68
77_K	133_I	0.959	0.68
170_I	173_T	0.959	0.68
13_G	184_D	0.956	0.68
92_I	118_M	0.955	0.68
95_N	107_A	0.953	0.67
50_F	54_L	0.949	0.67
136_L	163_T	0.946	0.67
26_V	67_F	0.941	0.66
152_A	170_I	0.940	0.66
153_V	156_A	0.931	0.66
144_T	184_D	0.931	0.66
59_E	65_D	0.930	0.65
159_S	162_P	0.912	0.64
51_W	139_N	0.911	0.64
122_N	126_S	0.896	0.63
158_S	162_P	0.891	0.62
96_L	100_F	0.890	0.62
134_T	188_Y	0.890	0.62
32_K	35_K	0.886	0.62
37_A	162_P	0.880	0.61
46_S	49_V	0.878	0.61
60_Q	65_D	0.874	0.61
72_R	84_P	0.862	0.60
115_M	132_M	0.858	0.59
65_D	69_R	0.857	0.59
48_L	52_L	0.854	0.59
9_L	13_G	0.852	0.59
46_S	50_F	0.840	0.58
121_L	125_R	0.836	0.57
27_N	64_L	0.814	0.55
135_F	177_G	0.800	0.54
51_W	110_L	0.796	0.53
121_L	129_S	0.795	0.53
166_V	185_R	0.794	0.53
59_E	90_G	0.793	0.53
129_S	157_Y	0.793	0.53
31_F	110_L	0.791	0.53
136_L	173_T	0.791	0.53
14_L	23_L	0.787	0.53
11_V	15_V	0.782	0.52
82_I	122_N	0.781	0.52
167_G	171_L	0.775	0.52
82_I	88_A	0.766	0.51
137_A	167_G	0.762	0.50
134_T	166_V	0.757	0.50
168_P	173_T	0.755	0.50
93_L	137_A	0.753	0.49
130_R	189_Y	0.751	0.49
45_M	52_L	0.747	0.49
41_S	52_L	0.746	0.49
3_N	6_W	0.745	0.49
2_V	13_G	0.745	0.49
22_T	26_V	0.744	0.49
105_N	153_V	0.740	0.48
54_L	113_K	0.739	0.48
55_M	58_A	0.734	0.48
6_W	170_I	0.734	0.48
9_L	141_S	0.733	0.48
48_L	91_Y	0.732	0.47
72_R	150_V	0.732	0.47
159_S	165_I	0.730	0.47
92_I	132_M	0.730	0.47
46_S	184_D	0.729	0.47
122_N	131_S	0.724	0.47
11_V	25_D	0.723	0.47
7_V	37_A	0.716	0.46
8_S	15_V	0.714	0.46
144_T	154_R	0.711	0.46
112_I	116_E	0.705	0.45
54_L	58_A	0.705	0.45
10_T	22_T	0.704	0.45
9_L	20_N	0.702	0.45
131_S	144_T	0.696	0.44
151_I	159_S	0.696	0.44
47_V	50_F	0.693	0.44
186_Y	189_Y	0.691	0.44
183_I	187_F	0.688	0.43
32_K	179_G	0.687	0.43
16_F	138_V	0.686	0.43
26_V	169_S	0.686	0.43
87_P	117_Q	0.684	0.43
14_L	17_A	0.679	0.43
37_A	155_M	0.678	0.43
44_L	94_S	0.674	0.42
138_V	177_G	0.674	0.42
119_K	123_G	0.672	0.42
142_C	172_A	0.672	0.42
178_I	182_I	0.671	0.42
98_A	109_P	0.670	0.42
83_P	115_M	0.664	0.41
93_L	142_C	0.660	0.41
74_F	118_M	0.659	0.41
23_L	163_T	0.655	0.40
136_L	172_A	0.653	0.40
173_T	181_I	0.651	0.40
81_D	188_Y	0.647	0.40
4_I	7_V	0.646	0.40
164_D	168_P	0.645	0.40
151_I	165_I	0.643	0.39
48_L	157_Y	0.642	0.39
112_I	135_F	0.639	0.39
128_A	136_L	0.639	0.39
81_D	161_T	0.637	0.39
3_N	31_F	0.630	0.38
130_R	185_R	0.629	0.38
6_W	57_I	0.628	0.38
69_R	186_Y	0.627	0.38
54_L	65_D	0.626	0.38
128_A	133_I	0.624	0.38
77_K	181_I	0.623	0.38
33_G	135_F	0.622	0.38
19_C	160_K	0.618	0.37
100_F	180_A	0.616	0.37
75_I	93_L	0.615	0.37
142_C	151_I	0.614	0.37
33_G	141_S	0.612	0.37
5_I	161_T	0.610	0.36
36_E	39_T	0.610	0.36
30_V	150_V	0.609	0.36
29_A	43_G	0.607	0.36
136_L	177_G	0.605	0.36
46_S	94_S	0.599	0.36
91_Y	110_L	0.599	0.36
15_V	183_I	0.598	0.35
96_L	130_R	0.597	0.35
89_M	137_A	0.596	0.35
34_A	96_L	0.595	0.35
123_G	127_E	0.595	0.35
100_F	136_L	0.594	0.35
34_A	70_M	0.593	0.35
47_V	149_T	0.593	0.35
142_C	173_T	0.592	0.35
36_E	97_M	0.590	0.35
70_M	127_E	0.585	0.34
55_M	152_A	0.585	0.34
70_M	125_R	0.581	0.34
51_W	180_A	0.573	0.33
31_F	58_A	0.567	0.33
42_F	74_F	0.566	0.33
91_Y	120_K	0.565	0.33
112_I	134_T	0.563	0.32
52_L	87_P	0.563	0.32
27_N	149_T	0.562	0.32
38_I	161_T	0.559	0.32
21_G	30_V	0.558	0.32
27_N	104_G	0.557	0.32
130_R	184_D	0.555	0.32
79_F	151_I	0.555	0.32
150_V	165_I	0.554	0.32
110_L	135_F	0.554	0.32
28_E	49_V	0.553	0.32
162_P	165_I	0.552	0.32
65_D	138_V	0.550	0.31
81_D	129_S	0.548	0.31
38_I	77_K	0.547	0.31
51_W	92_I	0.545	0.31
97_M	110_L	0.542	0.31
168_P	184_D	0.535	0.30
153_V	165_I	0.530	0.30
89_M	93_L	0.529	0.30
20_N	157_Y	0.526	0.30
79_F	132_M	0.526	0.30
33_G	42_F	0.525	0.29
95_N	111_G	0.523	0.29
57_I	65_D	0.522	0.29
143_I	153_V	0.521	0.29
146_I	161_T	0.521	0.29
104_G	185_R	0.520	0.29
15_V	25_D	0.517	0.29
152_A	175_I	0.516	0.29
104_G	132_M	0.516	0.29
45_M	60_Q	0.514	0.29
82_I	92_I	0.512	0.28
33_G	143_I	0.511	0.28
52_L	86_H	0.509	0.28
140_T	144_T	0.507	0.28
48_L	110_L	0.507	0.28
39_T	43_G	0.507	0.28
105_N	140_T	0.506	0.28
153_V	158_S	0.503	0.28
48_L	79_F	0.503	0.28
160_K	182_I	0.503	0.28
34_A	37_A	0.501	0.28
2_V	152_A	0.500	0.28

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4pd6A	3	0.8673	64.8	0.948	Contact Map
4f35D	2	0.898	51.6	0.952	Contact Map
4r1iA	2	0.8827	38.4	0.956	Contact Map
2kluA	1	0.199	30.1	0.958	Contact Map
2kv5A	1	0.1684	29.9	0.958	Contact Map
2m20A	2	0.1837	19.6	0.962	Contact Map
2ks1B	1	0.2194	12.9	0.965	Contact Map
4n7wA	2	0.8724	9.5	0.967	Contact Map
4b19A	1	0.1531	9.3	0.967	Contact Map
2mofA	1	0.1939	8.7	0.967	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0077 seconds.