SCPB - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

SCPB - Segregation and condensation protein B

UniProt:	P35155	Sequences: MGLDIVNWKAIVEALLYAAGDEGLTKKQLLTVLEIEEPELNTIMADVADEYRGDTRGIELIEYADTYMLSTKKDFAPYLKKLIEVPSKGLSQASLEVLAIVSYKQPITRAEIEEIRGVKSERILHSLVAKALLCEVGRADGPGRAILYGTTPTFLEQFGLKTLDELPPLPENAEEDVLQEEADLFFENFNQTFEDIK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	197 (170)
Sequences:	2859 (1905)
Seq/√Len:	146.1

BACSU - SCPB

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
136_V	149_G	5.562	1.00
9_K	50_E	4.587	1.00
9_K	46_D	3.449	1.00
11_I	78_Y	2.819	1.00
14_A	75_F	2.709	1.00
10_A	75_F	2.587	1.00
138_R	146_I	2.455	1.00
62_E	161_K	2.444	1.00
50_E	56_R	2.443	1.00
113_E	120_S	2.235	1.00
60_L	69_L	2.182	1.00
161_K	165_E	2.020	1.00
8_W	43_I	1.974	1.00
59_E	72_K	1.969	1.00
47_V	51_Y	1.962	1.00
36_E	39_E	1.946	1.00
13_E	51_Y	1.942	1.00
135_E	146_I	1.925	1.00
150_T	155_L	1.865	1.00
15_L	24_L	1.795	1.00
131_A	153_T	1.775	1.00
105_Q	150_T	1.763	1.00
25_T	28_Q	1.752	1.00
103_Y	167_P	1.743	1.00
12_V	43_I	1.731	1.00
45_A	48_A	1.685	1.00
26_K	41_N	1.678	1.00
111_E	139_A	1.655	1.00
68_M	156_E	1.646	1.00
142_P	145_A	1.630	1.00
29_L	40_L	1.627	1.00
61_I	70_S	1.600	1.00
23_G	66_T	1.599	1.00
162_T	165_E	1.596	1.00
134_C	149_G	1.577	1.00
91_S	94_S	1.556	1.00
128_V	133_L	1.542	1.00
26_K	40_L	1.540	1.00
107_I	111_E	1.536	1.00
30_L	40_L	1.529	1.00
62_E	67_Y	1.525	1.00
101_V	124_L	1.490	1.00
9_K	43_I	1.490	1.00
43_I	46_D	1.453	1.00
34_E	81_K	1.444	1.00
62_E	65_D	1.403	1.00
28_Q	31_T	1.401	1.00
14_A	79_L	1.389	1.00
48_A	60_L	1.373	1.00
33_L	40_L	1.373	1.00
35_I	40_L	1.366	1.00
13_E	56_R	1.350	1.00
100_I	115_I	1.333	1.00
44_M	60_L	1.322	1.00
22_E	28_Q	1.304	1.00
41_N	62_E	1.293	1.00
105_Q	163_L	1.289	1.00
137_G	147_L	1.285	1.00
52_R	72_K	1.273	1.00
45_A	49_D	1.237	1.00
48_A	62_E	1.225	1.00
27_K	37_E	1.224	1.00
16_L	69_L	1.216	1.00
17_Y	58_I	1.214	1.00
168_P	171_E	1.213	1.00
49_D	52_R	1.193	1.00
153_T	156_E	1.185	1.00
140_D	144_R	1.184	1.00
112_I	124_L	1.158	1.00
26_K	67_Y	1.153	1.00
101_V	133_L	1.141	0.99
15_L	82_L	1.137	0.99
46_D	49_D	1.130	0.99
42_T	45_A	1.085	0.99
126_S	130_K	1.060	0.99
57_G	75_F	1.060	0.99
54_D	72_K	1.059	0.99
104_K	111_E	1.054	0.99
39_E	42_T	1.052	0.99
100_I	107_I	1.051	0.99
97_V	118_V	1.037	0.99
52_R	59_E	1.037	0.99
8_W	35_I	1.024	0.99
50_E	54_D	1.023	0.99
141_G	145_A	1.020	0.99
41_N	45_A	1.018	0.99
102_S	154_F	1.012	0.99
72_K	75_F	1.003	0.99
63_Y	66_T	0.997	0.99
10_A	72_K	0.975	0.98
15_L	32_V	0.973	0.98
17_Y	71_T	0.954	0.98
78_Y	82_L	0.944	0.98
57_G	71_T	0.942	0.98
16_L	24_L	0.941	0.98
139_A	145_A	0.933	0.98
154_F	158_F	0.913	0.98
17_Y	69_L	0.913	0.98
104_K	115_I	0.908	0.97
134_C	151_T	0.908	0.97
23_G	129_A	0.906	0.97
24_L	29_L	0.905	0.97
59_E	73_K	0.905	0.97
15_L	29_L	0.903	0.97
105_Q	149_G	0.895	0.97
42_T	46_D	0.882	0.97
48_A	52_R	0.881	0.97
63_Y	68_M	0.879	0.97
51_Y	69_L	0.878	0.97
12_V	29_L	0.874	0.97
108_T	145_A	0.873	0.97
27_K	31_T	0.872	0.97
25_T	66_T	0.871	0.97
26_K	62_E	0.868	0.97
35_I	39_E	0.865	0.97
105_Q	155_L	0.857	0.96
20_G	23_G	0.854	0.96
73_K	77_P	0.846	0.96
141_G	147_L	0.845	0.96
10_A	57_G	0.844	0.96
123_I	126_S	0.836	0.96
90_L	94_S	0.835	0.96
19_A	24_L	0.830	0.96
12_V	40_L	0.822	0.95
11_I	14_A	0.819	0.95
46_D	50_E	0.816	0.95
97_V	120_S	0.813	0.95
32_V	82_L	0.804	0.95
39_E	43_I	0.801	0.95
124_L	133_L	0.800	0.95
135_E	148_Y	0.799	0.95
109_R	121_E	0.797	0.95
93_A	109_R	0.792	0.94
124_L	148_Y	0.781	0.94
13_E	57_G	0.776	0.94
37_E	41_N	0.774	0.94
40_L	43_I	0.770	0.94
18_A	82_L	0.767	0.93
65_D	161_K	0.763	0.93
17_Y	51_Y	0.757	0.93
51_Y	58_I	0.749	0.93
18_A	71_T	0.744	0.92
158_F	167_P	0.744	0.92
93_A	122_R	0.742	0.92
137_G	145_A	0.734	0.92
12_V	44_M	0.733	0.92
23_G	68_M	0.733	0.92
26_K	30_L	0.710	0.90
171_E	175_E	0.705	0.90
134_C	152_P	0.704	0.90
109_R	148_Y	0.699	0.90
10_A	74_D	0.696	0.90
94_S	123_I	0.694	0.89
153_T	157_Q	0.692	0.89
100_I	113_E	0.692	0.89
7_N	75_F	0.691	0.89
27_K	30_L	0.691	0.89
17_Y	158_F	0.688	0.89
11_I	75_F	0.687	0.89
7_N	55_T	0.679	0.88
137_G	149_G	0.679	0.88
105_Q	108_T	0.673	0.88
119_K	122_R	0.668	0.88
64_A	152_P	0.668	0.88
9_K	56_R	0.666	0.87
55_T	72_K	0.666	0.87
24_L	82_L	0.665	0.87
68_M	151_T	0.663	0.87
30_L	37_E	0.640	0.85
43_I	47_V	0.634	0.85
25_T	65_D	0.630	0.84
120_S	124_L	0.629	0.84
35_I	43_I	0.626	0.84
50_E	55_T	0.622	0.84
15_L	79_L	0.621	0.84
24_L	32_V	0.620	0.83
14_A	57_G	0.619	0.83
15_L	19_A	0.618	0.83
48_A	67_Y	0.616	0.83
106_P	147_L	0.615	0.83
94_S	122_R	0.613	0.83
63_Y	150_T	0.610	0.82
64_A	68_M	0.608	0.82
137_G	143_G	0.607	0.82
31_T	55_T	0.606	0.82
57_G	60_L	0.604	0.82
96_E	118_V	0.603	0.82
45_A	67_Y	0.603	0.82
18_A	80_K	0.603	0.82
128_V	135_E	0.600	0.81
171_E	174_E	0.599	0.81
25_T	41_N	0.594	0.81
96_E	113_E	0.591	0.80
160_L	167_P	0.591	0.80
11_I	32_V	0.587	0.80
90_L	132_L	0.581	0.79
44_M	48_A	0.578	0.79
88_K	125_H	0.578	0.79
44_M	67_Y	0.575	0.79
119_K	132_L	0.573	0.78
9_K	47_V	0.572	0.78
140_D	147_L	0.571	0.78
172_N	175_E	0.564	0.77
11_I	57_G	0.563	0.77
23_G	156_E	0.563	0.77
143_G	146_I	0.560	0.77
84_E	170_P	0.559	0.77
121_E	148_Y	0.557	0.76
7_N	74_D	0.555	0.76
22_E	88_K	0.554	0.76
109_R	113_E	0.554	0.76
30_L	34_E	0.553	0.76
146_I	149_G	0.548	0.75
96_E	112_I	0.548	0.75
110_A	142_P	0.547	0.75
15_L	134_C	0.547	0.75
112_I	177_V	0.547	0.75
144_R	159_G	0.546	0.75
129_A	141_G	0.545	0.75
96_E	116_R	0.544	0.75
89_G	97_V	0.543	0.75
87_S	121_E	0.541	0.74
110_A	124_L	0.539	0.74
11_I	81_K	0.539	0.74
15_L	33_L	0.538	0.74
168_P	172_N	0.537	0.74
65_D	121_E	0.535	0.74
34_E	42_T	0.532	0.73
89_G	130_K	0.528	0.73
119_K	138_R	0.527	0.72
61_I	159_G	0.527	0.72
112_I	120_S	0.525	0.72
44_M	93_A	0.525	0.72
115_I	118_V	0.525	0.72
16_L	151_T	0.520	0.71
103_Y	155_L	0.520	0.71
136_V	147_L	0.520	0.71
89_G	112_I	0.519	0.71
7_N	52_R	0.518	0.71
20_G	66_T	0.517	0.71
89_G	110_A	0.516	0.71
93_A	116_R	0.516	0.71
26_K	44_M	0.515	0.71
51_Y	56_R	0.512	0.70
105_Q	159_G	0.512	0.70
174_E	177_V	0.510	0.70
155_L	163_L	0.510	0.70
110_A	113_E	0.507	0.70
114_E	170_P	0.507	0.70
132_L	157_Q	0.506	0.69
79_L	130_K	0.505	0.69
79_L	83_I	0.504	0.69
173_A	178_L	0.504	0.69
66_T	152_P	0.501	0.69
56_R	69_L	0.500	0.69

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3w6jB	2	0.8477	100	0.098	Contact Map
2z99A	2	0.8071	100	0.118	Contact Map
4i98B	2	0.8325	100	0.127	Contact Map
1t6sA	4	0.8071	100	0.161	Contact Map
3w6kB	2	0.4416	99.8	0.688	Contact Map
1p4xA	1	0.8934	96.7	0.885	Contact Map
4asnA	2	0.401	94.7	0.902	Contact Map
2k4bA	1	0.3147	93.8	0.906	Contact Map
1okrA	2	0.5482	93.8	0.906	Contact Map
1p6rA	1	0.3807	93.6	0.906	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0068 seconds.