PPIB - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

PPIB - Peptidyl-prolyl cis-trans isomerase B

UniProt:	P35137	Sequences: MKTGYFLLEDGNKIEFELYPEAAPGTVANFEKLANEGFYDGLTFHRVIPGFVSQGGCPHGTGTGGPGYTIKCETEGNPHTHEAGALSMAHAGKDTGGSQFFIVHEPQPHLNGVHTVFGKVTSGLEFAKNMSNGDVMKEVRVEG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	143 (130)
Sequences:	10060 (5326)
Seq/√Len:	467.1

ECOLI - PPIA PPIB
BACSU - PPIB
HALSA - Q9HNW6

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
83_A	128_K	3.792	1.00
8_L	13_K	3.294	1.00
15_E	122_S	3.104	1.00
84_G	124_L	2.859	1.00
82_E	119_K	2.704	1.00
104_H	131_S	2.643	1.00
87_S	101_F	2.477	1.00
81_H	87_S	2.279	1.00
32_K	36_E	2.240	1.00
42_L	55_G	2.216	1.00
17_E	119_K	1.949	1.00
14_I	127_A	1.944	1.00
28_A	32_K	1.931	1.00
17_E	121_T	1.894	1.00
18_L	27_V	1.800	1.00
20_P	27_V	1.778	1.00
16_F	86_L	1.770	1.00
82_E	85_A	1.708	1.00
53_S	104_H	1.692	1.00
72_C	75_E	1.688	1.00
11_G	129_N	1.634	1.00
49_P	131_S	1.586	1.00
19_Y	22_A	1.577	1.00
14_I	120_V	1.540	1.00
19_Y	119_K	1.531	1.00
103_V	107_Q	1.529	1.00
44_F	55_G	1.528	1.00
48_I	52_V	1.500	1.00
85_A	119_K	1.479	1.00
70_I	73_E	1.471	1.00
59_H	63_T	1.465	1.00
31_E	35_N	1.432	1.00
85_A	103_V	1.408	1.00
38_F	66_P	1.403	1.00
53_S	130_M	1.394	1.00
49_P	132_N	1.375	1.00
22_A	78_P	1.328	1.00
17_E	20_P	1.313	1.00
37_G	40_D	1.242	1.00
26_T	117_F	1.239	1.00
85_A	116_V	1.229	1.00
81_H	101_F	1.213	1.00
43_T	60_G	1.206	1.00
66_P	97_G	1.196	1.00
26_T	88_M	1.195	1.00
128_K	131_S	1.193	1.00
25_G	28_A	1.183	1.00
47_V	130_M	1.180	1.00
58_P	64_G	1.168	1.00
87_S	111_N	1.163	1.00
49_P	135_V	1.150	1.00
42_L	57_C	1.141	1.00
120_V	124_L	1.140	1.00
81_H	111_N	1.132	1.00
84_G	128_K	1.122	1.00
16_F	102_I	1.120	1.00
11_G	133_G	1.117	1.00
22_A	79_H	1.101	1.00
14_I	102_I	1.052	1.00
65_G	98_S	1.038	1.00
70_I	96_G	1.036	1.00
15_E	121_T	1.035	1.00
120_V	127_A	1.031	1.00
82_E	106_P	1.029	1.00
58_P	65_G	1.025	1.00
38_F	58_P	1.018	1.00
25_G	71_K	1.014	1.00
87_S	116_V	1.008	1.00
71_K	74_T	1.007	1.00
50_G	105_E	0.999	1.00
86_L	117_F	0.996	1.00
23_A	27_V	0.991	1.00
102_I	127_A	0.987	1.00
80_T	111_N	0.984	1.00
32_K	35_N	0.983	1.00
26_T	115_T	0.983	1.00
33_L	36_E	0.978	1.00
70_I	74_T	0.978	1.00
124_L	127_A	0.963	1.00
69_T	72_C	0.963	1.00
47_V	53_S	0.951	1.00
90_H	95_T	0.945	1.00
46_R	54_Q	0.945	1.00
90_H	114_H	0.927	1.00
15_E	123_G	0.920	1.00
94_D	112_G	0.920	1.00
80_T	108_P	0.917	1.00
124_L	128_K	0.915	1.00
28_A	31_E	0.905	1.00
27_V	31_E	0.887	1.00
67_G	97_G	0.879	1.00
23_A	115_T	0.876	1.00
90_H	96_G	0.872	1.00
38_F	98_S	0.862	1.00
9_E	12_N	0.854	1.00
12_N	126_F	0.852	1.00
47_V	104_H	0.838	1.00
104_H	127_A	0.836	1.00
134_D	137_K	0.811	1.00
16_F	120_V	0.810	1.00
45_H	60_G	0.810	1.00
125_E	129_N	0.804	1.00
62_G	65_G	0.800	1.00
91_A	95_T	0.800	1.00
52_V	104_H	0.796	1.00
70_I	75_E	0.787	1.00
83_A	124_L	0.787	1.00
57_C	62_G	0.780	1.00
126_F	129_N	0.779	1.00
58_P	61_T	0.759	1.00
79_H	116_V	0.756	1.00
51_F	54_Q	0.756	1.00
72_C	96_G	0.748	1.00
8_L	11_G	0.747	1.00
32_K	37_G	0.746	1.00
54_Q	99_Q	0.744	1.00
33_L	38_F	0.733	1.00
83_A	105_E	0.732	1.00
133_G	136_M	0.720	1.00
68_Y	97_G	0.710	1.00
78_P	81_H	0.710	1.00
45_H	99_Q	0.705	1.00
20_P	28_A	0.690	1.00
81_H	103_V	0.689	1.00
38_F	42_L	0.683	1.00
102_I	120_V	0.678	1.00
29_N	68_Y	0.676	1.00
69_T	75_E	0.674	1.00
88_M	96_G	0.671	1.00
30_F	117_F	0.671	1.00
52_V	109_H	0.665	1.00
12_N	129_N	0.663	1.00
123_G	126_F	0.662	1.00
68_Y	72_C	0.658	1.00
108_P	111_N	0.655	1.00
69_T	97_G	0.655	1.00
74_T	112_G	0.648	1.00
83_A	106_P	0.645	1.00
9_E	14_I	0.641	1.00
121_T	125_E	0.641	1.00
72_C	90_H	0.630	0.99
73_E	94_D	0.629	0.99
20_P	31_E	0.626	0.99
122_S	125_E	0.626	0.99
11_G	126_F	0.619	0.99
54_Q	89_A	0.617	0.99
83_A	104_H	0.612	0.99
13_K	126_F	0.608	0.99
93_K	112_G	0.606	0.99
48_I	51_F	0.606	0.99
93_K	96_G	0.602	0.99
19_Y	85_A	0.593	0.99
69_T	74_T	0.588	0.99
77_N	115_T	0.587	0.99
8_L	15_E	0.586	0.99
43_T	61_T	0.584	0.99
9_E	126_F	0.573	0.99
49_P	134_D	0.573	0.99
49_P	104_H	0.573	0.99
89_A	99_Q	0.573	0.99
129_N	132_N	0.568	0.99
18_L	117_F	0.568	0.99
71_K	94_D	0.567	0.99
103_V	106_P	0.567	0.99
75_E	78_P	0.566	0.99
25_G	73_E	0.563	0.99
14_I	124_L	0.563	0.99
44_F	48_I	0.559	0.99
58_P	98_S	0.557	0.99
64_G	67_G	0.557	0.99
46_R	101_F	0.556	0.99
105_E	109_H	0.556	0.99
50_G	131_S	0.551	0.99
71_K	91_A	0.550	0.99
11_G	130_M	0.549	0.99
92_G	96_G	0.544	0.99
51_F	110_L	0.542	0.98
29_N	32_K	0.539	0.98
82_E	111_N	0.539	0.98
46_R	89_A	0.538	0.98
52_V	102_I	0.537	0.98
53_S	102_I	0.532	0.98
32_K	68_Y	0.531	0.98
23_A	26_T	0.530	0.98
68_Y	71_K	0.522	0.98
74_T	93_K	0.515	0.98
71_K	75_E	0.511	0.98
28_A	68_Y	0.510	0.98
19_Y	79_H	0.510	0.98
68_Y	74_T	0.507	0.98
128_K	132_N	0.504	0.98
92_G	95_T	0.503	0.98
120_V	123_G	0.502	0.97
55_G	86_L	0.501	0.97
80_T	112_G	0.500	0.97

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2b71A	1	1	100	0.123	Contact Map
3bo7A	3	0.979	100	0.123	Contact Map
1zkcA	1	1	100	0.123	Contact Map
2k7nA	1	1	100	0.125	Contact Map
2x7kA	1	1	100	0.127	Contact Map
2poeA	1	1	100	0.128	Contact Map
2ok3A	1	0.986	100	0.129	Contact Map
2fu0A	1	0.993	100	0.129	Contact Map
1w74A	1	0.986	100	0.134	Contact Map
2mvzA	1	1	100	0.135	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0057 seconds.